KEGG   Octadecabacter antarcticus: OAN307_c06310Help
Entry
OAN307_c06310     CDS       T02538                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
oat  Octadecabacter antarcticus
Brite
KEGG Orthology (KO) [BR:oat00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    OAN307_c06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PIRT
Motif
Other DBs
NCBI-ProteinID: AGI66358
UniProt: M9R3M2
Position
604337..605872
Genome map
AA seq 511 aa AA seqDB search
MLLTNVPPHLGGTMTDNNSSGDLRHLDTLDRDLARFSRLEMATQYVARPIVGPGISLVFI
LLAGLGAALFFGQTNNAMIVIVATCLGAYMALNIGANDVANNMGPAVGANALTMGGAIAI
AVVFESAGALLAGGDVVSTIAKGIIAPESMGDPATFIWAMMAALLSAALWVNLATYVGAP
VSTTHSVVGGVMGAGIAAAGFAAVSWDTMGAIAASWVISPVLGGAVAAFFLFVIKSRIIY
RDDKIAAARRWVPVLVGIMAGAFGAYLALKGLKKIIKIDMPTALLIGLAIAVVVWLVMIP
VIKKQSEGLENRNKSLKVLFGIPLVVSAALLSFAHGANDVANAVGPLAAIVQVSQSGDFT
HDFSIPFWVMVIGAFGISFGLFLFGPKLIRMVGSQITKLNPMRAYCVALSAAITVIVASW
LGLPVSSTHIAVGGVFGVGFYREWDAERRLRNARAAMPDRAAYSAEERRRRKLVRRSHFM
TIIAAWIITVPAAALLSAVIFYGLVTVVGTA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgttactgacaaacgtgccgccacacctagggggcacgatgaccgacaacaatagcagc
ggcgatctgcgacacttagacacgctagatcgcgatctggcgcgtttttcccgacttgaa
atggcgacacaatatgtggcgcgtccaatcgttggaccgggcatttcgttggtgtttatt
ctgttggcgggtttgggtgccgcgctgtttttcgggcaaaccaacaatgcgatgatcgtg
atcgttgcgacttgtcttggcgcatatatggcgctgaatatcggggccaatgacgtggcc
aacaacatgggccctgccgttggggcgaacgcattgaccatgggcggggccatcgcgatt
gcggtggtgttcgaaagtgcaggtgcgttgctggcgggtggtgacgttgtgtcgacgatc
gccaagggcatcatcgcgcccgaaagcatgggtgatccggcgacgtttatctgggcgatg
atggcggcgctgctgtcggcggcgttgtgggtcaacctcgcgacatatgtcggcgcgcct
gtgtccacgacccattcggttgttggtggtgtgatgggtgcgggcattgcggccgcaggt
ttcgctgccgtgagctgggacacgatgggcgcgattgctgcgtcttgggtgatttcacct
gtgctgggcggtgctgttgcggcgttctttttgttcgtgataaaatcacggatcatctac
agggacgacaaaatcgcggcggcccgtcgttgggtgcctgttttggtcggcatcatggcg
ggcgcgtttggcgcgtatctggcgctgaagggcttgaagaaaatcatcaaaatcgacatg
ccaacggcgcttttgatcggcctggcaatcgcagttgttgtttggctggtcatgattccg
gtgatcaaaaagcagtccgagggtcttgagaaccgtaacaaatccctcaaggttctgttt
ggcatcccgttagttgtttcggcggcactactgagctttgcacatggcgccaacgacgtg
gccaacgcggttggtccactggccgcgatcgtgcaggtgtcgcaatcgggtgatttcacc
cacgatttcagcatcccgttctgggtcatggtcatcggcgcgttcggtatttcgtttggc
ttgttcttgtttgggccaaagctgatccgcatggttggtagccagatcaccaaattgaac
ccgatgcgcgcctattgtgtggccctgtcagcggcgatcacggtgattgtggcgtcgtgg
ttgggtctgcccgtcagttccacgcacatcgccgtgggcggtgtgtttggcgttggtttt
taccgtgaatgggacgcggaacgccgattgcgcaacgcccgcgccgcaatgcccgatcgc
gccgcttattcagccgaagaacgccgtcgtcgtaaattggtgcgccgttcgcatttcatg
acgatcatcgcggcgtggatcattacggtgccagccgccgcgttgctgtcggcggtgatt
ttctacggcttggtgacggttgtcgggacggcttaa

DBGET integrated database retrieval system