KEGG   Octadecabacter antarcticus: OAN307_c30920Help
Entry
OAN307_c30920     CDS       T02538                                 

Definition
(GenBank) SMP-30 family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00053  Ascorbate and aldarate metabolism
oat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    OAN307_c30920
Enzymes [BR:oat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     OAN307_c30920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: AGI68630
UniProt: M9RFM9
Position
complement(3074234..3075121)
Genome map
AA seq 295 aa AA seqDB search
MIPTREGKLTCAELIFDCKNKHGEGIFWNAIDGLVWWTDIEGRTLWSFDPVTSRGQPYPM
EDRVCCFAPRASGGLIVAFADRISLLDLDNGTEEKICDFEPDNLETRTNDGRTDRLGRFV
VGGMNEVSGAANSSVIRIDGDLKVETLLEGVACANSICFTADGKTMYFADTPEREILAFD
YDSKLSGRRVLTSFEGEPGLPDGSSVDAEGGVWNAEWEGRRVVRVNPEGHIDTVIDMPVW
KPTCCAFGGPNLDTLFITTSCLMSNEATLKREPNSGGLFAVKPGFNGLQDIPFCS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgattcctacacgggagggtaagttgacctgcgctgaactcatctttgattgtaaaaac
aagcatggtgaaggcattttttggaatgccattgatggtttggtttggtggacagatatt
gagggccgcacgttgtggtcgtttgatccggtgacatcgcgaggccagccctatccaatg
gaagatcgggtttgctgttttgcaccacgcgcatctggtgggttgattgtcgcctttgcc
gaccgaatttccctgcttgacttggacaacggtacagaagaaaaaatctgtgattttgaa
ccggacaatctggagacacgaacaaacgacgggcgtactgataggctgggccgtttcgtc
gtggggggcatgaatgaggtctctggggcggcgaattcgtctgttatccggatcgacggt
gatctgaaggtcgaaacgctgttagaaggtgtcgcctgtgccaattccatctgtttcaca
gcggacggcaagacgatgtactttgctgacacgccagagcgtgaaatcctcgcatttgac
tatgattcgaagctgtcgggacgacgcgttttgacctcttttgagggtgagcctggattg
ccggatgggtccagcgtggatgcagaaggcggcgtctggaatgcagaatgggagggcaga
cgcgttgtgcgcgtcaaccctgaaggacacatcgacaccgtcatcgacatgcctgtctgg
aagccgacttgctgtgcattcggtgggccgaacctcgacacactttttataacgacatca
tgtttgatgagcaacgaagccacgctcaaacgtgaaccaaattcgggtgggctgtttgcg
gtcaaacccggcttcaacgggttacaggacattccgttctgcagctga

DBGET integrated database retrieval system