KEGG   Octadecabacter antarcticus: OAN307_c33950Help
Entry
OAN307_c33950     CDS       T02538                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00071  Fatty acid degradation
oat00072  Synthesis and degradation of ketone bodies
oat00280  Valine, leucine and isoleucine degradation
oat00310  Lysine degradation
oat00362  Benzoate degradation
oat00380  Tryptophan metabolism
oat00620  Pyruvate metabolism
oat00630  Glyoxylate and dicarboxylate metabolism
oat00640  Propanoate metabolism
oat00650  Butanoate metabolism
oat00900  Terpenoid backbone biosynthesis
oat01100  Metabolic pathways
oat01110  Biosynthesis of secondary metabolites
oat01120  Microbial metabolism in diverse environments
oat01130  Biosynthesis of antibiotics
oat01200  Carbon metabolism
oat01212  Fatty acid metabolism
oat02020  Two-component system
Module
oat_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OAN307_c33950 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    OAN307_c33950 (thlA)
   00640 Propanoate metabolism
    OAN307_c33950 (thlA)
   00650 Butanoate metabolism
    OAN307_c33950 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OAN307_c33950 (thlA)
   00072 Synthesis and degradation of ketone bodies
    OAN307_c33950 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OAN307_c33950 (thlA)
   00310 Lysine degradation
    OAN307_c33950 (thlA)
   00380 Tryptophan metabolism
    OAN307_c33950 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OAN307_c33950 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OAN307_c33950 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OAN307_c33950 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oat04147]
    OAN307_c33950 (thlA)
Enzymes [BR:oat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OAN307_c33950 (thlA)
Exosome [BR:oat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OAN307_c33950 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI68896
UniProt: M9RET3
Position
complement(3343957..3345132)
Genome map
AA seq 391 aa AA seqDB search
MSVVIVGAARTPMGGFQGALSTVTATDLGAAAIRGALENGDVSPGGVDEVLMGCVLPAGL
GQAPARQAALGAGLPQSVPCSTVNKVCGSGMKTVMAAHDQIIAGSQDLMIAGGMESMSGA
PYLSLKTRDGARLGHVEMKDHMFLDGLEDAYTRGALMGTFAEACAEQYQFTREAQDAYAL
GSLSNALAAQKSGAFDGEITNVTVMSRKGDVTVSLDEQPGNARPDKIPTLRPAFKKDGTV
TAANASSISDGAAAIVLTSETHAQVCGLTMRARIVGHASHAQDPAWFTTAPVPATQKLLT
RIGWSVDDVDLWEVNEAFAVVPMAFMQDLGIEREKMNVNGGACALGHPIGASGTRIIVTL
LNALEKRGLKRGIAAICIGGGEGTAIAVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttgtgattgttggtgcagcccgcaccccgatgggcggatttcaaggtgcattg
tccaccgtcacggcaaccgatcttggggcagcagccattcgtggtgcgctggaaaatgga
gacgtgtcgccgggcggcgtcgacgaggtcttgatgggctgtgttttgcccgcaggattg
ggccaagcgcccgcacgtcaggccgcattgggcgctggattgccgcaatcggttccgtgc
agcacggtaaacaaggtctgcggatcgggcatgaaaacagtgatggcggcgcatgaccag
atcattgctggtagccaagacttgatgatcgcgggtggcatggaaagcatgtcgggtgcg
ccgtatttgtcgttgaagacacgcgatggtgcgcggttgggtcatgtcgaaatgaaggac
cacatgtttctcgacgggcttgaagacgcttacacgcgtggcgcgttgatgggcacattc
gccgaagcctgcgccgagcaatatcagttcacacgtgaggcacaggacgcctatgcgctt
gggtcactatcaaacgcattggccgcccaaaagtccggtgcgtttgacggtgaaatcacc
aacgtcaccgttatgtcgcgcaaaggcgatgtgaccgtgtcgcttgatgaacaaccgggc
aatgcacggcccgacaagatccctacgttgcggcctgccttcaagaaagatggtactgtg
acagccgctaatgcatcgtcaatttcagacggggcggcggcgatagttttgaccagtgag
acgcacgctcaggtgtgcggactgacaatgcgggcccgcatagtgggccatgcaagccat
gcgcaagatcccgcatggttcacaacagcaccggtgcctgcaacgcaaaagttactgacc
cgtatcggatggagcgtcgatgacgtcgatctgtgggaggtcaatgaggcctttgcggtg
gtaccgatggccttcatgcaagaccttggaattgagcgtgaaaagatgaacgtaaatggt
ggggcctgtgcgctcggtcatccgattggcgcatcgggaacacggatcatcgtgaccctg
ctgaatgcgctggaaaagcggggtcttaagcgtggtatcgctgcgatttgtattggtggc
ggtgaggggactgcgatcgcagttgagcgcccttga

DBGET integrated database retrieval system