KEGG   Octadecabacter antarcticus: OAN307_c34220Help
Entry
OAN307_c34220     CDS       T02538                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase MetG
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00450  Selenocompound metabolism
oat00970  Aminoacyl-tRNA biosynthesis
oat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    OAN307_c34220 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OAN307_c34220 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oat01007]
    OAN307_c34220 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oat03016]
    OAN307_c34220 (metG)
Enzymes [BR:oat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     OAN307_c34220 (metG)
Amino acid related enzymes [BR:oat01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   OAN307_c34220 (metG)
Transfer RNA biogenesis [BR:oat03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    OAN307_c34220 (metG)
 Prokaryotic type
   Other AARSs
    OAN307_c34220 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGI68916
UniProt: M9REV6
Position
3369351..3371063
Genome map
AA seq 570 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLIGSQLPADLYARYLRGRGHEVLFLCATDEHGTPAELAA
AKAGKPVADYCAEMWTVQADLATRFGLSFDHYGRSSSLQNRALTQHFAGVLADNGLIEER
METQMYSHEDGRYLPDRYIEGTCPNCGFESARGDQCDNCTKQLDPVDLINPYSTISGSTD
LEMRDTKHLYLLQSKLKDEIEAWIDSQTGWPVLTTSIAKKWLNDGDGLQDRGITRDLDWG
VPVMRGDAPWPGMEDKVFYVWFDAPIEYIACAQEWSDATGGQDWARWWRTDKGADDVRYT
QFMGKDNVPFHTLSFPATIIGSGEPWKRVDYLKSFNFLNYDGGQFSTSRGRGVFMDQALE
ILPADYWRWWLLSRAPETSDSEFTWDAFQVDTNKDLADVLGNFVSRVTKFCRSKFSEAVP
AGGEYGDAENKLIADLQTRLTTYQAAMDAIEVRKAAAELRAMWAAGNEYLQAAAPWSVFK
EDPDKAAAQIRLALNLIRIYAVLSAPFIPTASATLLSAMNTMDMDWPDDMNASARALSAG
HAFTVPDNLFAKISDEQREEWVEKFAGTRD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcacctcatcacatcggcgattccgtatatcaacgggatcaaacacctcggc
aacctgatcggcagtcaattgcccgctgatctgtacgcacgctatctgcgcgggcgtggc
catgaagtgctgtttttgtgcgccacggatgagcacggcacccccgctgaactggccgcc
gccaaagcaggcaaaccagttgcagactattgcgccgagatgtggactgtacaagcggat
ttagccacgaggttcgggttgtcgtttgatcactacggacggtcctcttcgctgcaaaac
cgcgccttaacgcagcactttgccggtgttctggccgacaacgggttgatcgaagaacgc
atggaaacccagatgtattcccatgaagacgggcgatacctgccggatcgctacatcgaa
ggcacctgccccaactgcggttttgaatcagcgcgtggcgatcagtgcgacaattgcacg
aagcagctggatccagtcgatttgatcaatccgtattcgacaatttccggttcaaccgat
ctggaaatgcgcgacaccaaacatttgtatctgctgcaatccaagctcaaggacgaaatt
gaggcatggatcgacagccagacaggctggcccgttctgacgacgtcgattgcaaagaaa
tggctgaacgacggcgacggtttgcaggaccgtggcatcacccgtgaccttgactggggc
gtgcccgtgatgcgcggcgacgccccttggcccggtatggaagacaaggttttctacgtc
tggtttgacgcgcccatcgaatacatcgcctgcgcgcaagaatggtcagacgcgaccggt
ggccaagattgggcgcgctggtggcgcacggataaaggcgccgatgatgtgcgctatacg
cagttcatgggcaaagataatgtgccgttccacacgctgagctttcccgccacgatcatc
ggatctggtgaaccttggaaacgggtcgactacctgaaatcgttcaactttttgaactac
gatggcgggcaattttccacatcacgcgggcgcggtgtgttcatggatcaagcgcttgaa
atcctaccggcggactattggcgctggtggctgttgtcgcgcgcacctgaaacctcggat
tcagaattcacttgggacgcgttccaggtggacacgaacaaagacctcgccgatgtattg
ggtaacttcgtgtcccgtgttacgaaattctgccgttcaaaattctccgaagccgtgcca
gcgggtggcgaatacggcgacgctgagaacaaacttatcgctgatctgcaaacccgcctg
acgacgtatcaggccgctatggatgccatagaagtacgcaaagccgccgccgaattgcgc
gcaatgtgggccgctggcaacgaatatttgcaggccgccgcaccgtggtcggtgtttaag
gaagaccccgacaaggcagcggcgcaaatccggctcgcgcttaacctgatccgtatttac
gctgttctttcagcgccattcatcccgaccgcgtctgccacgttgttatcagcaatgaac
acgatggatatggactggcccgacgacatgaacgcatccgcgcgcgcgctgtccgcagga
cacgcgtttactgtcccagacaatctgttcgccaaaatttctgacgaacaacgggaagaa
tgggtcgaaaagttcgccggaacccgcgactaa

DBGET integrated database retrieval system