KEGG   Octadecabacter antarcticus: OAN307_c46190Help
Entry
OAN307_c46190     CDS       T02538                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
oat  Octadecabacter antarcticus
Brite
KEGG Orthology (KO) [BR:oat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oat03016]
    OAN307_c46190 (truB)
Enzymes [BR:oat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     OAN307_c46190 (truB)
Transfer RNA biogenesis [BR:oat03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    OAN307_c46190 (truB)
 Prokaryotic type
    OAN307_c46190 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 VirB8
Motif
Other DBs
NCBI-ProteinID: AGI69969
UniProt: M9RBM6
Position
4544557..4545462
Genome map
AA seq 301 aa AA seqDB search
MARKRKGRDLHGWLVVDKPAGITSTSVVNKVKWALDAKKAGHAGTLDPDATGVLAVALGE
ATKTVPYITDALKAYTFTVRLGQKTNTDDAEGEITAQSDTRPTDDEIKAQLAQFVGDIMQ
TPPLFSAVKIDGERAYKRARDGEEFEIAARPLWVEELLLTDRPDVDHVTLEMTCGKGGYV
RAIARDLGDALGCFGHVRELRRVWSGPFDAKDGVTLDQLDTHAKTDGLDHLILPLEAGLT
DLPRVHCPESSVTKLRNGNPALVMGDVEYGDECWADHSGQAIAVGIFKSGELHPTRVFVR
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaacgcaaaggacgcgacctacacgggtggcttgtcgtggacaaaccggcg
gggatcacgtcgacatcagttgtcaacaaagtaaaatgggcgctggatgcgaaaaaggcc
ggtcatgcgggcaccttggatcctgacgcgacgggcgttttggccgtagccttgggcgag
gcgacaaaaactgtcccctacatcaccgacgcgctaaaagcctacacattcaccgtgcgt
cttgggcaaaaaaccaacaccgacgacgccgaaggcgaaattaccgcccaaagtgacacg
cgcccgacagatgatgaaatcaaagcccagctcgcccaatttgtcggcgacatcatgcag
acgccgcctcttttctcagctgtcaagattgatggtgaacgcgcctacaaacgcgcccgc
gacggtgaggaattcgaaatcgcagcacgccccctttgggtcgaagaactgttgctgaca
gaccgacctgacgtcgaccacgtcacgcttgaaatgacctgcggcaaaggcggctacgta
cgcgccattgcccgcgacctaggcgacgccttgggttgttttggccacgtgcgcgaattg
cgtcgtgtctggtctggcccgtttgatgccaaagacggcgtcacgctggaccaattggac
acgcatgcgaaaaccgacgggctcgaccatctgatcctgcccctcgaagcgggcctcacc
gacctgccgcgcgtccattgcccggaatcgagtgtcaccaagctgcgcaacggcaacccc
gcgctggtcatgggcgacgtggaatacggtgacgagtgttgggccgaccattcaggccaa
gccatcgccgtcggcatattcaaatccggtgaacttcacccaacgcgggtgttcgtacgt
tcttaa

DBGET integrated database retrieval system