KEGG   Octadecabacter antarcticus: OAN307_c47500Help
Entry
OAN307_c47500     CDS       T02538                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00970  Aminoacyl-tRNA biosynthesis
oat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OAN307_c47500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oat03029]
    OAN307_c47500
Enzymes [BR:oat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     OAN307_c47500
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     OAN307_c47500
Mitochondrial biogenesis [BR:oat03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    OAN307_c47500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGI70096
UniProt: M9RI75
Position
4677057..4678454
Genome map
AA seq 465 aa AA seqDB search
MRPLVGLSMRGMVATVHANKENTMQDWLWATAADLGRGIDAGDIDPVELCEVYLAAIDAH
PMRDRIYARVTADRARSEAAAARMRAKAGQRLSPLDGVPISWKDLFDTAGVATEAGTKLM
EGRVPSRDAEVLRVATGMGLVCLGKTHMSEIAFSGLGYNPMTATPPCVNDPDAVPGGSSS
GAAASVAFGLAAAAVGSDTGGSVRVPSVWNDLVGLKTTFGRLSVAGSVALCTTFDTVGPL
CRSVEDAALMLAALEGGRSADLTGASLKGMRFAALRSVVMDNVADASLAGYDAALTKLAV
AGAEIVPLEVPALERAFAMSLPLYTADAYANWRDLVEANPDKMYHQILQRVQGGKDVLAH
EYLSLWVELRDIRGVYADATAGFDAVLCPGAANMPPNLERLASDADYYLQENLLTLRNTR
VANLMGLASLALPTGVPSVGIMLNVAGGDDERLLRIGAAVEAALA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctttggtgggattgtccatgcgcgggatggtcgctaccgttcacgccaacaag
gagaacacgatgcaagattggctttgggcgacagcggcagatttggggcgcgggattgat
gccggtgatattgatccggttgagctttgtgaggtttatctggcggcgattgacgcgcat
ccaatgcgggatcggatctatgcgcgggtgacggcggaccgtgcgcggagtgaggccgca
gccgcgcgcatgcgggccaaggcagggcagcgattgtcgcctttggacggtgtgccgatc
agctggaaggatttgtttgatacggcgggtgtcgcaaccgaagcagggaccaaattgatg
gagggtcgtgtgccaagccgcgatgcagaggttctgcgcgtggcgacgggcatggggcta
gtgtgtcttggaaaaacccacatgagcgagatcgcgttttctggtttgggatataacccg
atgaccgcaacaccgccttgtgtgaatgatccagacgcggttccggggggatcgtcgtcc
ggcgctgcggcgtctgttgcgtttggactggcggcagcggctgtcgggtcggacacgggc
gggtctgttcgtgtgccatcggtctggaatgaccttgtggggctgaagaccacgtttgga
cgcttgtcggtcgcagggtctgtcgcgctctgcacgacgtttgataccgtggggccgctg
tgtcgatcggtagaagacgcagcgttgatgctggcagcgcttgaaggcggtcggtcggca
gatttgacgggtgcatctttaaaggggatgcggtttgcagcgttgcgatcggttgtgatg
gacaatgtcgcagatgcgtcgttggcaggatatgatgcggcgttgaccaagctggcggtg
gcgggcgctgagattgtaccgctggaagtgcccgcgttagaacgcgcctttgcgatgtct
ttgccgctttataccgcggatgcctatgccaattggcgtgatctggtcgaggcgaatccg
gacaaaatgtaccaccagattttgcagcgtgtgcaggggggcaaggatgtacttgcccac
gaatatctgtcgctttgggtggaattgcgcgacattcggggtgtctatgctgacgcgact
gcggggtttgatgcagtgctgtgtcctggagctgcaaacatgccgccgaatttggaacgg
ctggcgtcagacgctgattattacctacaggaaaacctgctgacattgcgcaatacgcgg
gtcgcgaacctgatgggtttggcgtctttggcactgcctacaggggtgccatcggtcggg
attatgctgaatgttgcggggggtgatgatgaacgcctactgcggattggtgcggcggtt
gaggctgcgttggcgtaa

DBGET integrated database retrieval system