KEGG   Osmia bicornis bicornis: 114876873Help
Entry
114876873         CDS       T06109                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
obb  Osmia bicornis bicornis
Brite
KEGG Orthology (KO) [BR:obb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:obb04131]
    114876873
Membrane trafficking [BR:obb04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    114876873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 114876873
NCBI-ProteinID: XP_029044594
Position
Unknown
AA seq 1988 aa AA seqDB search
MSSVQRAFTQKLSKQHAADVRRQIASSTSYSRDLSKSGSSFSGFSSTMSLCEVLEPLDYE
EFLAQHQSVLDRDPLKSILDFPPEDVELKVINRKIRTEEPIVPHESLDTVSPYVRRCIDS
FTSDWVIVHRKYKRRVSPIARDRLLQDTPRQDFEVDQEDTNDSGSPNEEEDLSSSGETPR
GSWASLDLRHSQHDPLLPTLLDRVCPETIDQMNEQKRSEDRQEALFPLYAPPASPDDEWQ
EISPAPEPSEPFAHKILVKCLQLKLELEVEPIFASLALYDAKEKKKVSENFYVDMNSEGL
KRMLGSHIAYSDASTLARSCVMSINKPSPDLFLVVRLEKVLQGDISECAEPYLREDKNKD
KVRAAATAACERLGRYRMPFAWTAIHLSGVIGGGGDTDSTGSAGSLDRKSGGLEQWRKKV
EPPTRRGSLERRSSDKRRSWSPDDFANCLDTFRPITLTVSSFFKQESERLRDEDLYKLLV
ELRRPGSNLKRLKCLPGILKLDLSPRPEELPRCLDPDLRRLIPYPDEKSRPVKEILEFPS
EVISPDLTYRNLLYIYPKEANFSSRTGSARNIAVRIQLMGGEQEADALTAIFGRSSCPEM
THECFTSVSYHNKNPNFYDEVKIRLPADLSAKHHLLFTFYHISCQKKAEQPNVETAVAYT
WLPLLRDGHLQSGEFSLPAMLDPPPPNYSYIAPDVLLPGTRWVDAHRGVFTVILEPVSSV
HPQDKYIDRFLSLCGYLETGQVPPRIGEAGMESELKSALLELARASHSALVRSLPQLLDQ
LISLLVRPPTLPSQPLNVAATIFEAIGLLVRNITNLPDGQLDAHGRHALLATYVAYQCSL
PRMTHTQGIVRAQSNPDLPLEDLEMEVHSRGLDRTASMRQESPSINNQPTRRLLHEELAL
HWVVSTGQARELAVTYSWFFLELIVRSMVVTLAEMDILEAPRKSRFSPQFCDDVATLTAA
LTSEVISRCGKENRVPNNLISSLGNFLSDLLSVMDRGFVLSLIRAACCSLSDASMHIPDS
AALFALKLDLVRTVCSHEHYVALNLPFGTGYTSGSAPASPSPSTGSSGSLISTLVPGDRA
RFSELSQEFRQQHFLVGIVLSDLSNTLEIPNPMLQNKAIGTVRHLMAYHDADSRYSDPSA
KARVAALYLPLLNIIMDALPQLYHWDSKDKSVYPDESGSITQSVALAISGRVSADTAGTQ
CRVSLSSEATRHLLMCVLWVLKGLEQSALVQWCAELSSRRILCLLQVLNIATAAFEYKGK
KALKRLPPQAAATSDIRSRLEDVILGQGSARSEMMLRRKERMSGDKLRWRKDQMPYRSCE
QSEGRAVEQDAHIEGALAAEASLVVLDTLETVVQADGGGGAVVGAVLKVLLRALARNQST
SVLQHMFNTQRALVFKYHSALFDEESERCGDLCLTLLTRCSSPLSAVRSHAAASLYLLMR
QNFEIGNNFARVKMQVTTSLSALVGRGRAPSEGALRRALKTVLVYAERDTELADTSFPEQ
VKDLLFNLHMILSDTVKMKEFQEDPEMLLDLMYRIAKGYQGSPDLRLTWLANMAQQHMER
KNHTEAAMCLVHSAALVAEYLHLLEPGGGGRPVGAVALAPVTPNALEESAVGDDVLARRE
EGLCLGPDFSESGLAGLLEHAASSFHAAGMYEAIPDVYRVLLPIAEAAHDYKKLANIHGK
LHEAYTRVEQLAGKRVFGTYFRVGFYGGRFGDLAGEEFVYKEPTLTKLPEIFSRLENFYA
ERFGAENIVIIKDSNPVDPSKLEPDKAYVQITYVEPYFEPHELRHRPAIFHRNFNIKRFV
YATPFTPGGKAHGELREQCKRKTILTVATHFPYLKTRIRVVARKQIVLSPIEVAIEDIQK
KTAEVAAATAQEPPDAKILQMVLQGCIGTTVNQGPAEVAVVFLSGLREQNAQPTRLQHKL
RLCFKDFSKKCLDALRRNKNLIGPDQRDYQRELERNYQRLTERLTPLIAWSGPPLGSQQN
MPSISPRW
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgtacaaagggcttttactcagaaattgagtaaacagcatgcagctgacgtt
agacgtcagattgctagttctacctcatattcacgtgatctgtctaagagtggcagctca
ttctcaggcttttcttcaacgatgtcactatgtgaggtactggagccattagactatgaa
gaattcttagctcaacatcagtctgttcttgatcgagatcctctcaaatcaatattagac
tttccacctgaggatgttgagttaaaagtaataaacagaaaaattcgaacagaagaacca
attgttccccatgaatccttggatacagtatctccttatgttagaaggtgtatcgacagt
tttacttctgactgggttatagttcacaggaagtacaagcgtagagtgtctcctattgca
agagacagattactgcaggataccccaagacaagatttcgaggtggatcaagaggacaca
aatgattcaggatcaccgaatgaagaagaggatctatcaagctctggtgaaacaccaagg
ggatcttgggcaagtttggacttaagacattctcaacacgaccctcttctcccgaccttg
ttggaccgggtctgtccagaaaccatcgatcaaatgaacgaacagaagagatcggaagat
cgtcaagaagcattgtttccactttatgcacctccagcttccccagatgatgagtggcaa
gagattagtccagcaccggagccttccgaaccttttgcccataagattcttgttaaatgt
cttcaattgaaattagaattggaagttgaaccgatttttgcgagtctagcactgtacgat
gccaaagaaaagaagaaggtatccgagaacttttacgtggacatgaattcagagggtttg
aaaagaatgcttggaagtcacattgcatacagtgatgccagcactttggcaagaagctgt
gtgatgagtatcaataaaccaagtccagatttgtttttagttgtcagacttgagaaggta
ttgcaaggtgatatatcagaatgtgctgagccatatttgcgcgaagataaaaataaagat
aaagtgagagcagcagcaacagctgcatgcgagcgattgggtcgctatagaatgccattt
gcatggactgccatccacctttctggagtaataggaggtggtggagacacggatagcacc
gggagtgctggatctttggacagaaaatcaggtggactggaacagtggcgtaaaaaggta
gaacccccaactagaaggggctcattggaaagaagaagttctgacaaaagacgcagttgg
tcacctgatgactttgctaattgcctggacacatttaggcctatcacgttgaccgtgtca
agtttctttaagcaagaaagtgaacgtctaagagacgaagatctttacaagcttttagtt
gaactacgaagaccaggttctaatttgaaacgattaaaatgtctaccaggtattctgaaa
ttggaccttagtcctagacctgaagaattgcccaggtgtttagaccctgacctcaggaga
ttgataccgtacccggatgagaaaagtagaccagttaaagagatattagagtttccaagt
gaagttatttctccggatttaacatatcgtaatcttctttatatctatccgaaggaagca
aatttcagttctagaactggctctgctcgaaacatcgccgtgagaattcaactgatgggc
ggtgaacaagaagctgatgctcttacagctatttttggaagatcatcctgccctgaaatg
actcacgaatgctttacttccgtatcctatcacaacaagaatccaaacttttatgacgaa
gtgaaaattcgactccctgccgacctgagtgcaaagcaccacttattattcacgttttac
cacatcagttgccaaaagaaagcggagcaaccgaacgtggagactgctgtagcatacacg
tggttaccacttctgagagatggacacttgcaatctggagagttcagtcttccagcaatg
ctggatccacctccaccaaattactcgtacatcgcccctgatgttctactacctggtaca
agatgggtagacgcacacagaggcgtttttacagtgattttggaacctgtctccagtgta
catccgcaagataaatacatagataggttcttgtcattgtgtggttacttggaaactggc
caagtgcctccgcgaattggcgaggcaggaatggagtccgaattaaaatcagccctgctg
gaattggcaagggcgtcacattctgctttagtacgatctctacctcaacttctggatcaa
ttaatatctctgctagtacggcccccgacattaccgtctcaaccactgaacgtggcggcc
acaattttcgaggctataggtctgttggtacgaaacattaccaatttgccagatggccaa
ttggacgcccacggaagacacgcgcttttggctacatacgtcgcttatcagtgctccttg
ccaaggatgacgcacacccagggcatcgtccgagctcagagcaaccctgatctacctctg
gaggacttagaaatggaagtgcactccagaggactggatcgaaccgcgtcgatgcgtcaa
gaatcaccctcgataaacaatcaaccaacgaggagacttctgcacgaagagttagctttg
cattgggtcgtgtctacgggccaggcacgtgaattggcagtcacgtactcctggttcttc
ttggaattgatagttcgttccatggtagtgacgttggcagaaatggacatactggaggct
ccacgaaaatccagattctctcctcaattctgcgacgacgtggctacactcacagccgcg
ttaacgtccgaggtgatatcccgatgtggaaaggagaacagggtacccaacaatctgata
tcgagtctcggtaacttcctctctgatttgctgtctgtgatggacagaggattcgtcttg
tccttgatcagagctgcatgttgctctctgtcggatgcatctatgcacatccctgattcg
gctgcccttttcgcactgaaactcgatcttgtgcgaacggtatgctcccatgaacactac
gtggcattgaatcttcccttcgggactggatatacatcaggatcggcgcctgcatcgcct
agtccatcaacggggagctcaggtagtttgatatccactttggtacctggagaccgagcc
agattctcggaactcagtcaggaatttcggcagcaacacttcttggtgggcatcgtctta
tcagatttgtccaacactttggaaatacccaatcctatgcttcaaaacaaagctatcggg
accgttcgccatcttatggcctaccatgacgcggattccaggtattccgacccctctgcg
aaagctagagtcgctgcactgtatttgcctcttttaaatatcataatggatgctcttcca
caactctatcattgggattccaaggacaagagcgtgtaccctgatgaatctgggtccatc
acccagtctgtagcactggctatatcgggaagagtttctgcggacactgcaggcacccag
tgcagggtttccttaagttctgaggctacgcgacacttattgatgtgcgttctatgggta
ctgaagggtttggaacagtccgcgttagtgcaatggtgtgcagaattaagttccaggcgt
atattgtgccttcttcaagtcctgaatattgctacggcagcctttgagtataagggtaag
aaagcactgaagagactaccgccacaggcagcagccaccagtgatattcgatccagactg
gaggatgtgattctcggtcaaggaagtgccagaagtgaaatgatgttacgaagaaaggag
agaatgagtggggataaattgagatggcgtaaagaccagatgccttatagatcgtgcgaa
caatcagaagggagagcagtggaacaagatgctcatatagaaggtgccttagcagctgaa
gcctcccttgtagtcttggatactttagaaacagtcgttcaggctgatggtggaggaggt
gcagttgtaggagcagtgttgaaagtacttttaagggctttggccagaaatcaaagtaca
tctgtattgcaacacatgttcaacacgcaacgtgctttggtattcaagtaccatagtgct
ctgtttgatgaagagagcgaaagatgcggtgatttatgtttaacgttactaactaggtgt
agttctcccttaagtgctgtgcgcagccatgctgctgccagtctttatctactgatgcgt
cagaacttcgagatcggtaataatttcgcacgagttaagatgcaagtcacaacatctctc
tcagctctcgttggaagaggaagagctcctagcgaaggagcacttagaagagcattaaag
acagtgctagtgtatgctgagagagacacagaattggcggacacaagttttccagaacaa
gtaaaagacctattattcaatctgcacatgatactatctgacactgttaaaatgaaagaa
ttccaagaggatccagaaatgcttttagatctcatgtacagaattgcaaagggatatcag
ggttcaccagatcttaggcttacatggctggcaaacatggctcaacaacacatggaaaga
aaaaaccatacagaagctgctatgtgtttggtacatagtgctgctttggtagcagaatat
ttacacctcctggaaccaggtggtggtggaagaccagttggagctgttgctttagctcct
gttactccaaatgctttggaggaaagtgctgttggcgatgatgtgttagcaagaagagaa
gaaggtctatgtttgggtccagatttttcagaaagtggcttagcaggtttattagaacat
gctgccagttccttccatgcagctggaatgtacgaagctattcctgatgtgtacagagtg
ttgcttccaattgcagaagctgctcatgattacaaaaaattggctaacatccatgggaaa
cttcatgaagcatacacacgagtggagcaattagcagggaaacgagtattcggtacatat
ttcagagttggtttctatggtggacgatttggcgatcttgctggcgaggaatttgtttat
aaagagcctactctaacgaaattaccagagatattttcgagacttgagaatttttatgct
gaaagattcggtgccgagaacattgtgataataaaagactcgaatcctgtagaccccagt
aaattagaaccagataaagcctatgttcaaattacctatgtagaaccatattttgagcca
catgaactcaggcacagaccagctatttttcataggaattttaatatcaagagatttgtg
tatgcaacaccattcacacctggaggtaaagctcatggggagctgagagaacaatgtaaa
cgtaaaacaatattaacagtagctacacatttcccttatctgaaaacaagaattcgggtg
gtggctagaaagcaaatagttctaagtccaattgaagttgcaattgaagatatacaaaag
aaaactgcagaagttgctgcagctacagctcaagaaccacctgatgcaaaaatactgcaa
atggttttacaaggatgcattggaacaactgtgaatcaaggaccagcagaagttgcagtt
gtatttctctctggattaagagaacaaaatgcacagcctactagattgcaacataaactg
cgtttatgtttcaaagatttttcaaaaaagtgtctggatgctttgagaagaaacaagaac
ctaattggcccagatcagagagactatcaaagagaattggaaaggaactaccaaagatta
actgagagacttactcctcttattgcatggagtggacccccattaggaagccaacaaaat
atgccatcaatatcaccgcgctggtaa

DBGET integrated database retrieval system