KEGG   Osmia bicornis bicornis: 114877599Help
Entry
114877599         CDS       T06109                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8 isoform X1
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
obb  Osmia bicornis bicornis
Pathway
obb00061  Fatty acid biosynthesis
obb01100  Metabolic pathways
obb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:obb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    114877599
Enzymes [BR:obb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     114877599
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     114877599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD Sacchrp_dh_NADP Polysacc_synt_2 2-Hacid_dh_C RmlD_sub_bind NmrA Shikimate_DH NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 114877599
NCBI-ProteinID: XP_029046211
Position
Unknown
AA seq 246 aa AA seqDB search
MVIGKLAFVTGAGSGIGREVCRTLAGQGAKVIAADRNLNNAQETVASLNDSNHLALNIDV
ANEQSVKGAFQSIISKYSVPPTIIINSAGITRDQFILKLTQDDFDQVLDVNLRGTFFMIQ
TAVKEMIDGNVSKDSSIVNLSSIIGKVGNMGQANYAASKAGVIALTRTACLEFGQFGVRV
NTVLPGFIQTPMTETVPDNVKGMFIKKIPLRRMGKPEEVAEVIVFLASSKSSYINGASIE
VTGGMT
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcggtaagctagcgtttgtaacaggcgcaggtagcggtataggcagagaagta
tgccgtaccttggcagggcaaggagccaaagttattgctgccgatcgaaacctaaacaat
gctcaagaaactgttgcatctttaaatgattccaatcatttagcattgaatatagatgtt
gcaaatgaacaaagcgttaagggggcatttcaaagtataataagtaaatattcagtaccg
ccaactattatcatcaattctgcaggcattacgcgtgatcagttcattttaaaacttaca
caggatgattttgatcaagtgttggatgtaaatttaaggggaacattttttatgatccag
acagcagtgaaagaaatgattgatggaaatgtaagcaaagatagctcgattgttaattta
agttcaattattggcaaagtaggaaacatgggtcaagctaattatgctgcatcaaaagct
ggtgtgatagcccttacaagaaccgcttgtttagaatttggacaatttggagtccgtgtc
aatacagtgctgcctggtttcatacaaacccccatgacagaaacggtacccgataacgta
aaaggaatgtttataaaaaaaatacctcttcgtagaatgggaaagccggaagaagtagca
gaagttattgtatttttagcatctagtaaaagttcctatatcaatggtgcttccatcgag
gtcacagggggaatgacctga

DBGET integrated database retrieval system