KEGG   Osmia bicornis bicornis: 114878569Help
Entry
114878569         CDS       T06109                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog isoform X1
Organism
obb  Osmia bicornis bicornis
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 DUF4327
Motif
Other DBs
NCBI-GeneID: 114878569
NCBI-ProteinID: XP_029048341
Position
Unknown
AA seq 1395 aa AA seqDB search
MDRRKIKLKGSLHKNLIGSQTSSQSNFDDISLTAKPARSKSLLLAEKTLSTESENKSSDE
DIFLNKDKAFTQAEKSKTLQDSILSRKRKSLSFNIPNSESDEDLGLPLAESTVLKKRRND
TDIIQEESVNNNCKNGSTNLLVTAKSHTNVVPAIKSEFVEFLSESGIKLNPVAPHLLCTD
IIKVQKKMKELLNSRKYEKQKIISLMEKYFENEQNLENALTDMELFVNDQVSKVLHSSSL
IKILLQVSELHPEIYSSLLSKLNEAVLIADSIESVPWALSLLQQFRFLDVVTNSDALTSS
LEQLLESCPIWFQSELLLFLPDIVTDKQHQTIADILNKVLEENSELINLILNCMSNLNLG
KEYLNEYKEKTLNLLKTNVNLNAVPAIISFVLEDCTDTEVFEKTLLILRNIDMQPLVGEE
VEKCYQNQLNIINTLKMNMFTSKNIVNTAITVIKDITNDPKPFDIILLLLIFSTTELKKK
NIETMFKQNIRSGFYRISLLNLLYNNYKQVVQELQSAALQISSNLLKTDQRVFIDFAIHW
LRLQFMCHKENIFKQREILEKIIFLMGDNDQTVKNALAFLCKMAMTEEEKPYLAQHCNHL
RILLEKMDNLGLEEVGTLNDLLQHLCSNSSSITDSLRNDLFILLQKQLSNFKPLIKCKGV
LAAVMAIKHLMLKAETSDAAYNLFKTVLNNVKTCSRSKALFYDQLTCIISQTQNINEQFL
ENLKDYIEEEFINENMIDKTSYRGELVPQFGLNNTKHEPRNDVLTFENKKHGAIVPISFK
LLRTCCTKLSETGDLDAINSLLGCAILMPEHFDITENYIMDLTICCINWFREVISGFVTQ
KDPLLQKKVLQRLDNLIYLQSKLSMMLSLCDTKYQPPPSYFHYFPIPPFMKNEKKVGKKS
KKGKKEPKKKSVSFNEDENWELGSKICSKNPVYFRRLDATIVHLLDVKVEMHKSQSTSYI
ISVKQICFIVKELLGVFEYDANEKFITDLIELLPKVCSKLQDIVDSLRTDSNSQNRDATR
LLLCLLTKIFDWKGFESVTYNVLLREGLRILASQVNESNAMLRSCKELVAEGCKYFESLF
DIVTQISLATALINVSKSLMKHSESYTKQSKEKYAKIAFGFLSLEWPEEKHSSPQYKTAV
IELLNNWIDNEPLPLKTITLMLEWLPDETAKLEKPQNSLSRLPSITRSNFHYLLKKIFDG
LITGIKIALPLTNNDPKRIKLWYEVAANVQKLVQICKTLTTKSNILIFIRHMPILLKSFL
SLGMPVLEYNLKYQTEDVTKILKMMQGGTRYLHTICCDSAEKKDLTLTKYVPAAKSILEK
LIYSVKGMLVLNNSPAAFWMGNLVNKNLEGHEILSQNLSSEASTTLSSFDAIDDVADVSP
DILESDNSSDDLDED
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaaagataaaattgaaaggtagtttacacaaaaacttaataggaagccaa
acatcgtcacaaagtaactttgatgatatatcattaactgcaaagccggcaagaagtaaa
agtttattattagctgaaaagacgttgtcaacagaaagtgaaaacaaatcatcagatgaa
gatatatttttaaataaggataaagcatttacacaagcagaaaaaagtaaaacacttcaa
gatagtatactatctcgtaaacgcaaatctttaagttttaatataccaaatagtgaaagt
gatgaagacctgggtcttcctttggcagaatctactgttttaaaaaaaagacgaaatgat
actgatattatacaggaagaatctgtaaataataactgtaaaaatggttcaacaaattta
ttagttacagcgaagagtcatacaaatgtagttcctgctataaaatctgaatttgttgaa
tttttatctgaatcaggtattaaattaaatccagttgctccacatttgctttgtacagat
attataaaggttcagaagaaaatgaaggaattattaaactcaagaaagtatgaaaaacaa
aagataatttccttaatggaaaaatattttgagaatgaacaaaatcttgaaaatgcacta
actgatatggaactgtttgttaatgatcaagtatcaaaagttttacacagttcgtctctt
ataaaaatcttattacaagtttcagagctgcatccagaaatatacagtagtctcctgtct
aaacttaatgaagctgtgctgatagctgattccattgaatctgtaccttgggctctttca
ctgttgcaacaatttcggtttttggatgttgtaactaattctgatgctttaactagtagc
ttagaacaacttttagaatcatgccccatatggtttcaaagtgaattacttttgttcttg
cctgatattgtaactgataaacaacatcaaactattgctgacattttaaataaagttttg
gaagaaaattctgaactaataaatttaatattaaattgtatgagtaatttaaatcttgga
aaggaatacttaaacgaatacaaggaaaaaacattaaatttattaaaaacgaatgtaaac
ttaaatgcggtacctgctattataagctttgtgttagaggattgtactgatacagaagtt
tttgaaaaaacattactaatattacgcaatattgacatgcaaccacttgttggagaagaa
gttgaaaaatgttatcaaaatcaattgaatataatcaacactctaaaaatgaatatgttt
acatcaaaaaatatagtaaatactgctatcacagttataaaagatattaccaatgatcca
aaaccatttgatatcattcttttactacttatattttcaacaacagagctaaagaaaaaa
aatattgaaactatgtttaaacaaaatatacggtctggattttatagaataagtttatta
aacttattatataataattataaacaggttgtgcaagagttacaatccgctgcattgcaa
atatcaagtaatttattaaaaacagatcaacgtgtatttattgattttgctattcattgg
ttacgcttacagtttatgtgtcataaagaaaatatatttaaacaacgtgagattctagaa
aagattatatttctcatgggtgataatgatcaaacagttaaaaatgcgcttgcatttctt
tgtaaaatggcaatgacagaagaagaaaaaccatatttagcacagcattgtaatcatctt
cgtattttacttgaaaaaatggataatttaggcttagaagaagttggcacattaaatgat
ttattgcagcatttatgttcaaactccagttccataactgactctttacgcaatgattta
ttcatattacttcaaaaacaattgtctaattttaaaccattaataaaatgtaaaggtgtt
ttagcagcagttatggcaataaaacacttgatgttaaaagcagaaacatctgatgcagct
tataatttatttaaaacggtattaaataatgtgaagacttgttcaaggtcgaaagcttta
ttttatgatcagttaacatgtattatttctcaaactcaaaatattaatgaacagtttctg
gaaaaccttaaagattatatcgaagaagaatttattaacgaaaatatgatcgataaaaca
agctacagaggagaattggtacctcaatttgggttgaataatacaaaacatgaaccaaga
aatgatgttttaacttttgaaaacaaaaagcatggcgcaattgtcccaatttcgtttaaa
cttctcaggacttgctgtacaaaactaagtgaaacaggagatttggatgctataaattct
cttttaggatgtgcaatattaatgccagaacattttgatattacagaaaattatataatg
gatttaacaatatgctgtattaactggtttcgagaagtaatcagtggttttgttacacaa
aaagatcctttattacaaaagaaagtattacaaagattagataatcttatatatttacaa
agtaaattaagcatgatgctttcattgtgtgatacaaagtaccagccacctccaagttat
tttcattattttccgataccaccgtttatgaaaaatgagaaaaaagtaggcaaaaaaagt
aaaaaaggaaaaaaggaacctaagaagaaatctgtcagttttaatgaagatgaaaactgg
gaattagggtctaaaatatgttctaaaaacccagtctattttcgaagattagatgcaacg
atagtacatttgttagatgtaaaagtagaaatgcataaatcacaatctacaagttacatt
atatctgtgaagcaaatatgtttcattgtcaaagaattgctaggagtttttgaatatgat
gctaatgaaaagttcataacagatttaattgaattattacccaaagtttgttcaaaattg
caagacattgtggatagtttaagaacggacagtaatagtcaaaatagagacgctactaga
ttactgttatgtttgttaacaaaaatttttgactggaaaggatttgaaagtgtcacttat
aacgtgttgttaagagagggcttacgaattttagcaagtcaagtgaatgaaagtaatgct
atgttaagatcctgcaaagaacttgttgcagaaggctgcaaatatttcgaatctttattt
gatattgttacacaaatatctttagctactgcattaattaatgtgtctaaatctttaatg
aaacattctgaatcttatactaaacaaagtaaggaaaaatatgcaaaaatagcatttgga
ttcttatctcttgaatggccagaggagaagcattctagccctcagtataaaacagcagta
attgaattgttaaacaattggattgataatgagccattaccgctaaaaacaattacatta
atgttagaatggttaccagatgaaactgcaaaattggaaaagcctcaaaattctttaagt
agattaccttcaataacaagaagtaacttccattatttacttaaaaaaatatttgatggt
ctgattactggtataaaaatagcacttccattaaccaataatgatcccaaaaggataaaa
ttatggtacgaagttgcggcaaatgttcagaagttagttcaaatatgtaaaactttaact
acaaaaagtaacatattaatttttataaggcatatgcccatcttattgaaatcattttta
agtctcggtatgccagttcttgaatataatttaaaatatcaaacggaagatgttactaaa
atattaaaaatgatgcaagggggtacgcgatatttgcatacaatatgttgtgatagtgca
gaaaagaaagatcttacattaacaaaatatgtccctgcagctaaatctatattagagaag
ttaatttatagtgtgaaaggaatgttagttcttaataacagtcctgctgctttttggatg
ggaaatcttgttaacaaaaatttagaaggtcatgaaattctctcacagaatttatcatca
gaagcaagtactactttatcaagttttgatgctattgatgatgtagctgatgtatcacca
gacatattagagagtgataattcaagtgatgatcttgatgaagattaa

DBGET integrated database retrieval system