KEGG   Osmia bicornis bicornis: 114878626Help
Entry
114878626         CDS       T06109                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
obb  Osmia bicornis bicornis
Pathway
obb00020  Citrate cycle (TCA cycle)
obb00640  Propanoate metabolism
obb01100  Metabolic pathways
obb01200  Carbon metabolism
Module
obb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
obb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:obb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114878626
   00640 Propanoate metabolism
    114878626
Enzymes [BR:obb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114878626
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114878626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 114878626
NCBI-ProteinID: XP_029048485
Position
Unknown
AA seq 333 aa AA seqDB search
MAVAVRTFSKFTVRNCGSLLGSQIRFNYTATRKNLKIDSNTKVICQGFTGKQGTFHCKQA
IEYGTKIVGGVSPKKAGTEHLGKPVYKTVKEAKEATGATATVIYVPPPAAASAIMEAIEA
EMPLIVCITEGIPQHDMVKVKRRLLEQTKSRLIGPNCPGIIAPEQCKIGIMPGHIHQKGK
VGIVSRSGTLTYEAVNQTTLAGLGQTLCVGIGGDPFNGTDFIDCLEVFLKDPQCDGIIMI
GEIGGSAEESAAEYLIEHNTGGKAKPVVSFIAGITAPPGRRMGHAGAIISGGKGGAQDKI
NALEKAGVIVTRSPAQMGNELLKEMTRLGLVCN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggctgtcaggacattttcaaaattcacagtcagaaattgtggaagtctgtta
ggttctcaaataagatttaattatacagctactagaaaaaatttaaaaattgattccaat
accaaagtaatatgtcaaggttttactggtaaacaaggaacgtttcattgcaaacaggcc
attgagtatggtactaaaatagtaggcggcgttagtcccaagaaggctggcacagaacat
cttggaaaaccagtttataaaactgtgaaagaggctaaggaagccacaggtgccacagct
actgttatctatgttcctccaccagcagcagcatcagctattatggaagctatagaggct
gaaatgccattaattgtatgtattactgaaggtattccacaacatgacatggtgaaagtt
aaaagacgactgttagagcaaaccaaatcgcgtttaattgggccaaattgtcctggaata
atagctccagaacagtgtaaaataggcattatgccaggccatatacatcaaaaaggaaaa
gttggtattgtatcaagatctggtactttaacatatgaggctgtgaatcaaacaaccctt
gctggtcttgggcaaactctctgtgttggaattggcggcgatccctttaatggaactgac
ttcattgattgtttggaagtatttcttaaagatccacagtgtgatggtattataatgatt
ggtgaaattggtggtagtgcagaagaatcagcagcagaatacctcattgaacataacact
ggtggtaaagctaagccagtagtgtcattcattgctggtatcactgctcctccaggacga
cgaatgggacacgctggtgcaattatttcaggaggaaaaggaggcgcgcaggataaaatt
aatgcactagaaaaggccggtgtaatagttactaggagtcctgcgcaaatgggaaatgaa
ctcttgaaagaaatgacacgtcttggcttggtgtgtaattaa

DBGET integrated database retrieval system