KEGG   Osmia bicornis bicornis: 114879359Help
Entry
114879359         CDS       T06109                                 

Definition
(RefSeq) insulin-degrading enzyme isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
obb  Osmia bicornis bicornis
Brite
KEGG Orthology (KO) [BR:obb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:obb01002]
    114879359
Enzymes [BR:obb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     114879359
Peptidases and inhibitors [BR:obb01002]
 Metallo peptidases
  Family M16: pitrilysin family
   114879359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Diphthami_syn_2
Motif
Other DBs
NCBI-GeneID: 114879359
NCBI-ProteinID: XP_029050032
Position
Unknown
AA seq 1019 aa AA seqDB search
MLLSRIVKSRNYYTVIQSFVIYRFKSSDVKISTTNMSPNNYVEKRFNEIIKSSNDKREYR
GLLLTNKMKVLLISDPTTDKSAASLNVNIGYLSDPDDLPGLAHFCEHMLFLGTEKYPEEN
EYNKYLAQHGGSYNAVTHMDHTNYYFDVQSEKLEGALDRFAQFFIAPLFTEDLTELELNA
IHSEHEKNLANDTWRIDQVEKSSADPNHPFSKFGTGSKETLDTIPRQKGINVRESLFKFY
KKFYSSNIMALCVLGKEDLDELEKMVVELFSQVENKEVEVPVWPEHPFNEKHFKTKWYIV
PIKDTRHLYITFPIPDLQEHYKSAPTYYISQLLGHEGEGSLLSALKAKGWCNSLGSGKRL
SARGFQFFVVYVELTEEGLQHIDDIVLLTFQYINMLKTQGPTEWFYHEYRDIAKMNFQFK
EKSSPSDYVSSIVQILQDYPIEEALTVNSLFPLWKPDLIEWVMEYLKPENVRIHAIAKLY
EGIADETEKWYGTSFKREKISDDIIEKWINAGLNSDLQLPPKNEFIAEKFDIKPAESNIT
KFPVIIEDTPLIRLWFKQDDEFLVPRANLSMDFVSPLAYMDPLSHNFCCIFVLLFRDALN
EYSYAANIAGLKWELVNSKYGITLGIGGYDHKQRVLLEKIIDKMINFKVDPKRFEIWKEN
YIRSLKNFEAEQPYQHAVYYLAVLLSEQVWMKDELLNATSQLTAERLQQFIPQFLSKIHV
ECLIHGNMTMSEAIETVGLIESKLKGSLPHMIPLLPRQLILHREIKLEDGHHFLFEVKNK
FHKSSCTQVYYQTGLQSTELNMLLELLAQLISEPCFTVLRTKEQLGYIVFSGVRRTNGAQ
GLRIIVQSERDPNYVEQKINAFLNSMLEYISSLTEEEFNRHKESLAVRRLEKPKKMTTLS
AIFWSEISVQQYNFDRANIEVAYLRTITQEQIMKFYEELLQNDIQHKVSVHVISTVKDAD
STEENTVESNENVTASNGKDTAAYKKIDDIISFKISQSLYPLLKPFSDIPRKGAHSSKL
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatcacgtatcgtcaaatctcgaaattattatacagttattcaatctttcgtt
atatacagatttaaatcatctgatgtgaaaatatccacaactaatatgtctccaaataat
tatgttgaaaagcgatttaatgaaataattaaatcctcaaatgacaaaagagaatataga
ggtttattgctcacaaataaaatgaaagtattactcattagtgatccaacaactgataaa
agtgctgcatcattgaatgtgaacattggttacttaagcgatccagatgatttaccaggt
ttggcacatttctgcgaacatatgttattcttagggacagagaaatatccagaagaaaat
gaatacaataagtatttagcacagcatggtggttcatacaatgcagtaactcatatggat
cataccaattattattttgatgtacagtcagaaaaattggagggtgcactagatcgcttt
gcacaattttttattgcaccccttttcacagaagatttaactgaattagaactaaatgct
attcattcggaacatgaaaaaaatttagcaaatgatacatggcgtattgatcaagtagaa
aaatcatctgctgatccaaatcatcctttttcaaagtttggtactggaagtaaagaaaca
ttggatacaattccaagacaaaaaggaataaatgttagagaaagcttatttaaattttac
aagaagttttactcttctaacataatggcactatgtgtacttggtaaagaggatttagac
gaacttgaaaaaatggtagtagagttattttctcaagtagagaacaaggaagttgaagta
cctgtatggccagagcatcctttcaatgaaaaacactttaagaccaagtggtatattgtt
ccaataaaagatacaagacatttatatattacatttcctatacctgacttgcaagaacac
tacaaatcagcgcctacatattacatttctcaattgttaggacatgaaggagaaggatca
ctattgtctgctttaaaagcaaaaggatggtgtaattctctaggatccggaaaacgattg
agtgccaggggtttccagttttttgttgtttatgttgagttaacagaagagggtcttcaa
catattgacgacattgttttgttgacttttcaatatatcaacatgctgaaaacccaagga
ccaaccgaatggttttatcatgaatatagagacattgcaaagatgaactttcaattcaaa
gagaagtcttcaccttcggattatgttagtagcatagtacaaatattgcaagattatcca
atagaagaagctttgacagtaaacagccttttcccgttatggaaaccagatttaattgaa
tgggtaatggaatatttaaaaccagaaaatgtgagaattcatgcaattgcaaaattgtat
gaaggcatagccgatgaaactgaaaaatggtatggtactagcttcaaaagagaaaaaata
tcagatgatataattgagaaatggattaatgctggtcttaattcagacttacaattgcca
cccaaaaacgagtttatagcagaaaaatttgatataaaaccagcagaaagtaatataacc
aaatttccagtaattatagaagatactccactaataagattatggtttaaacaagacgac
gaatttcttgtacctagagctaatttatccatggattttgttagtccactggcatacatg
gatcctcttagccataatttttgttgtatatttgtactattgttccgggatgcactaaat
gaatactcatatgctgctaatatagccggtctcaagtgggaacttgtcaatagtaaatat
ggaattacgttaggaatcggtggttacgatcataagcaacgagtactactagagaaaatt
atagacaaaatgattaattttaaagttgatccaaaaagatttgaaatttggaaagaaaat
tatattagaagtcttaaaaattttgaggctgaacagccataccagcatgctgtttattat
ctagctgttttattgtctgaacaagtttggatgaaggatgaattactaaatgcaacttcg
cagttgacagctgaaagacttcaacaatttattccacaatttttaagtaaaattcatgta
gaatgtttaatacacggtaatatgacaatgtcggaagctattgaaactgtcgggttaata
gaatcaaaattaaaaggctcgcttcctcatatgatacctcttttacctagacagttgatt
ttacatcgtgaaatcaaattagaagatggtcatcactttttgtttgaagtaaagaataag
tttcataaaagttcatgtacacaagtttattatcaaactggtttgcaatcaacagaatta
aatatgttactagaactgttagcacaacttatatcagaaccatgttttactgtattaaga
actaaagaacaattaggatatattgtatttagcggagttcgaagaacaaatggtgcacaa
ggtttaagaattatagttcaaagtgagagagatcctaattatgttgaacagaaaattaat
gcatttttgaattccatgttggaatacatatcatctttgacagaagaagaatttaataga
cataaagaatcattggcagtacgtcgtcttgagaaacctaaaaaaatgactactttatct
gcaattttctggagtgaaatttcagtgcagcaatataattttgatcgagcaaatatagaa
gttgcatatttaagaactataacacaggaacagataatgaagttttacgaagaactactt
caaaacgatattcaacataaagtatcggtacacgtaatttcgacagtaaaagacgcagat
tcgacagaagaaaatacagtggagtctaacgaaaatgttacggcatcaaatggaaaagat
actgctgcgtataaaaagattgatgatattatatcattcaaaattagtcaatctttgtat
ccattactaaaaccatttagtgatataccaagaaaaggagctcattcgtcaaaattataa

DBGET integrated database retrieval system