KEGG   Osmia bicornis bicornis: 114881523Help
Entry
114881523         CDS       T06109                                 

Definition
(RefSeq) autophagy-related protein 16-1-like isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
obb  Osmia bicornis bicornis
Pathway
obb04136  Autophagy - other
obb04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:obb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114881523
   04136 Autophagy - other
    114881523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:obb04131]
    114881523
   03029 Mitochondrial biogenesis [BR:obb03029]
    114881523
Membrane trafficking [BR:obb04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    114881523
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    114881523
Mitochondrial biogenesis [BR:obb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    114881523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 Ge1_WD40 HOOK Cytochrom_D1 HbrB V_ATPase_I Cluap1
Motif
Other DBs
NCBI-GeneID: 114881523
NCBI-ProteinID: XP_029054178
Position
Unknown
AA seq 570 aa AA seqDB search
MAASEPGVSSTPREDNNWRQNLILQLQERNRKQTYCFADLISLHNRLFENANTLRTENIQ
LTIANETLRREAVSGTPGLGVNSDLEARLLKQAEELATLHKRKGENTQQIVDLNNKLQEM
MKEFQAKETSLSESMELNANLRLEISKCLSRERELESINQMLKDEHQALQLAFASLEEKL
RKAQEENRQLVERLIKYKTRDAEKVNEENDNFLNESFSSPTAFLMHTISKFGKRQAKMQK
ELEDAARDTRPVSPDRSNLKEGIAGLPTAVPTKVSVTFNAHDGEVYAVKWSPVERILATG
GADRKVKLWNITKGTSESKGILVGSNAGVMSVDFDSTGTLILGASNDYASRVWTVSDLRL
KHTLTGHCGKVMAAKFLGEPSKVVTGSYDRTLKIWDLRSKACIETKFAGSSCNDLVTSDG
AGSTIISGHFDQRIRFWDTRAESSSNDILLEGKVTSLDLSRDANYLLSCVRDDTLKLIDL
RMKKIIGSFSADGFKVGFDWTRATFSPDGQYIAVGSSDGSVFIWSVATNLIETVLKNHSA
VVTAVSWHLHGTYLASVDRAKTVTVWGDHV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtgaacccggtgtatcatcaactcctagagaagataacaattggagacaa
aatttgatattacagctccaagaaagaaataggaagcaaacatattgttttgcagatctc
atcagtttgcacaacagactgtttgaaaatgcaaacacattgcgtacagaaaatattcag
ctaactatagcaaatgaaacactccgtcgagaggcagttagtggaactcctggattaggt
gtaaatagtgatcttgaagctcgtcttttaaaacaagcagaagagttagctacattacat
aagaggaaaggagaaaatacgcaacaaatagtagatcttaataataaattacaagaaatg
atgaaggagtttcaagcaaaggaaaccagcctttctgaaagtatggagcttaatgccaac
ttacgtttagaaataagtaaatgccttagtagagaaagggagttggaaagtattaaccag
atgttgaaagatgaacatcaagctctacaactcgcttttgcatctttagaagaaaagctt
aggaaagcacaggaagaaaatcgccagttagtggaacgcttaatcaagtacaaaacaaga
gatgcagaaaaagtaaatgaagaaaatgacaactttttgaatgagagtttttccagtccg
acagcctttttgatgcataccatatcaaagtttggaaagagacaagcaaagatgcaaaag
gaattggaggacgctgctcgtgacacacgaccggtcagtcctgacagatcgaatctaaaa
gaaggaattgctggtcttcctactgcggtaccgaccaaagtgtcggtcacatttaatgct
cacgacggagaagtttatgctgtaaaatggtctcctgttgagaggatccttgcgaccgga
ggggctgacagaaaggtgaagctttggaatatcacaaaaggtacctcggagagtaaagga
attcttgttggcagcaacgcaggagtaatgtctgttgatttcgattcaacggggacgctg
atccttggagcatctaatgattatgccagccgggtgtggactgtgagtgatcttcgacta
aagcacactctaacgggccactgcgggaaggtgatggcggcgaagtttcttggcgaacct
tcaaaagtagttaccggtagttacgatcgtaccctaaaaatttgggacctgcgtagcaaa
gcgtgcatagaaacaaaatttgcgggctctagttgcaacgacctcgtgacttccgatggg
gcaggctcgacgataattagcggccatttcgatcagagaatccgattttgggataccaga
gccgaatctagttcgaatgacattctattggagggaaaagtgacgtcattggatctgtcc
cgtgatgcaaattaccttttgagctgtgtcagggacgatacgttgaaactcattgacctg
cggatgaagaagatcatcggttcgtttagtgctgatgggttcaaagttggtttcgattgg
acacgagcaactttcagtcccgatggacagtacatagcagttggatcttcagatgggtcc
gttttcatttggtctgttgctacgaacttgatcgaaactgttctcaaaaatcattcggct
gtggtgacagctgtttcttggcaccttcacggcacctacctcgcatcggtggacagggcg
aaaacggtaacagtatggggcgaccatgtttga

DBGET integrated database retrieval system