KEGG   Lacunisphaera limnophila: Verru16b_00710Help
Entry
Verru16b_00710    CDS       T04567                                 

Gene name
ptrA_1
Definition
(GenBank) Protease 3 precursor
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
obg  Lacunisphaera limnophila
Brite
KEGG Orthology (KO) [BR:obg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:obg01002]
    Verru16b_00710 (ptrA_1)
Enzymes [BR:obg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     Verru16b_00710 (ptrA_1)
Peptidases and inhibitors [BR:obg01002]
 Metallo peptidases
  Family M16: pitrilysin family
   Verru16b_00710 (ptrA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-ProteinID: AOS43658
UniProt: A0A1D8ARY4
Position
827022..829874
Genome map
AA seq 950 aa AA seqDB search
MLPRFPSLGRSPRLALVPLLVLALAPLVRAALPADIPPRPQAPNDEAEYRRFTLDNGLKV
ILLSDPKLNKSSASLAVAAGSYSDPANRQGLAHFLEHMLFLGTEKYPDEADYGNYLKING
GYNNAYTAGDHTNYLLEIRHEAFEGALDRLSQFFIAPLFTPEFTEREMNAVNSENQKNLE
NDLWRQYQLTNTLYRPGHPANHFSTGNRDTLGGTTREELLAFYHAHYSANTMTLALVGKA
SLDELEQWARTYFTPIKNQQLKPIDYPADYLPPKAALRIARMEPIKDVRQLTLEFPLGAT
RPFWPSKPDRLLGFILGHEGEGSLLSALKAEGLATGMGASADANTKDFGSFNATISLTPA
GLEKYPRVLELFFAAISRLRSAGYPAYLFQERAAMARLDETFQDKGEGADRAVALANQIR
DFPLEIAEREPYLWLQEDPAAYATVLNQIRPDNMLVVLTAKGVPTDKSEPVYGTKYSYTE
ETGPAYTALLTPPEVAAIQLPKANPFIPASATVLPTQPIQLLDEPALSLLYAQDTEFQRP
MVAEVYRFRLPRALASLETSVLLRFYEACIRESLNEVAYTAGQAGLNFSFNAALEGVEIA
VEGYDASAPRLLDTIAANLVDFSLPDERFAAIKDRLLRELGNFPRADAYQILLETRRATV
REFHFRPDEQLPVAQGVTLAAVRDFARKLYTRGKLEALVHGNVTAADAIAHARRFGAALA
SQPVADADLLRRRLLAQPAGEALRTNEQLVVNNSAFRREYVLGDDSPEIRAATLVLGNFI
SEPFFSELRTRQQLGYIVGANAGGEENTNFAYFIIQSGEYPADEVEKRADDFIVKLPLML
SGLPDDAWASIIGGVRAQLEEKDKAIADRAKRLFALGYDRAGDWNRREETLAALDRLTKA
RTGEILDHALGLSTRQMRTYLGFARQHEAKAPQTPTYTDRPAWKQTRQFK
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgctgccacgattcccctccctgggccgttctccccggctcgcgcttgttcccctgctg
gtcctggccctcgcgcccctggtgcgcgccgccctgcccgccgacatcccgccccgcccg
caggcccccaacgatgaggcggaataccgccgcttcaccctggacaacggcctcaaggtc
atcctgctctccgacccgaagctcaacaagtcctccgcgtcgctcgctgtcgccgccggt
tcctacagcgacccggccaaccgccagggcctggcccacttcctcgagcacatgctcttc
ctcggcacggaaaaataccccgacgaggccgactacggcaattacctcaagatcaacggc
ggctacaacaacgcctacaccgccggcgaccacaccaattacctcctcgaaatccgccat
gaggccttcgagggcgcgctcgaccgcctgtcccagttcttcatcgccccgctcttcacg
ccggagttcaccgagcgcgagatgaacgccgtcaattccgagaaccagaagaacctcgag
aacgacctctggcgccagtaccagctcaccaacaccctctaccggcccggccacccggcc
aaccatttcagcacgggcaaccgcgacaccctcggcggcaccacccgcgaggagctcctc
gccttctaccacgcccactacagcgccaacaccatgaccctcgccctcgtgggcaaggcc
agcctcgacgaactcgagcagtgggcgcgcacgtacttcaccccgatcaagaaccagcag
ctcaagcccatcgactacccggccgactacctgccgcccaaggccgccctgcgcatcgcc
cgcatggagccgatcaaggatgtccgccagctcaccctcgagttccccctcggcgccacc
cgcccgttctggccgagcaaacccgaccgcctcctcggcttcatcctcggccacgagggc
gagggcagcctgctctccgcgctgaaggccgagggcctcgccaccggcatgggcgccagc
gccgacgccaacaccaaggatttcggctccttcaacgccactatctccctcacccccgcc
ggtctggaaaaatacccgcgcgtgctcgagctgttcttcgccgccatctcgcgcctccgc
agcgccggctaccccgcctacctcttccaggaacgcgccgccatggcccgcctcgacgag
accttccaggacaagggcgagggcgccgaccgtgcggtcgcgctcgccaaccagatccgc
gacttcccgctcgagatcgccgagcgcgagccctacctctggctccaggaggacccggcc
gcctacgccacggtcctgaaccagatccggcccgacaacatgctcgtggtcctcaccgcc
aagggcgtcccgaccgacaagtccgagcccgtctacggcacgaagtacagctacaccgag
gagaccggcccggcctacaccgccctgctcaccccgcccgaagtcgccgccatccagctg
cccaaggccaaccccttcatccccgccagcgccactgtcctgcccacccagcccatccag
ctcctcgacgagcccgcgctgagcctgctctatgcccaggacaccgagttccagcgcccg
atggtcgccgaggtctaccgcttccgcctgccccgcgcgctggcctccctcgagacctcc
gtcctgctgcgcttctacgaggcctgcatccgcgagtcgctcaacgaggtcgcctacacc
gccggtcaggccggcctgaacttctcgttcaacgccgccctcgagggcgtcgagatcgcg
gttgagggctacgacgcctccgccccgcgcctgctcgacaccatcgccgccaacctcgtg
gacttctccctccccgacgagcgcttcgccgccatcaaggaccgcctcctgcgcgaactc
ggcaacttcccgcgcgccgacgcctaccagatcctgctggaaacgcgccgcgccaccgtc
cgcgagtttcacttccgccccgacgagcagctccccgtcgcccagggcgtgaccctcgcc
gccgtccgcgacttcgcccggaaactctacacccgcggcaagctcgaggccctcgtgcac
ggcaacgtcaccgccgccgacgccatcgcgcacgcccgccgcttcggcgccgcgctcgcc
agccagcccgtggccgacgccgacctcctgcgccgccgcctgctggcccaaccggccggc
gaggccctgcgcaccaacgagcagctcgtggtgaacaactccgccttccgccgcgagtac
gtgctcggcgacgactcgcccgagatccgcgccgccacgctcgtgctcggcaacttcatc
agcgagccgttcttctcggagctccgcacccgccagcagctcggctacatcgtcggcgcc
aacgccggcggcgaggagaacacgaacttcgcctacttcatcatccagtcgggcgaatat
ccggccgacgaggtcgagaagcgcgccgacgacttcatcgtcaagctgcccctgatgctc
agcggcctgcccgacgatgcctgggcctccatcatcggcggcgtccgggcccagctcgag
gagaaggacaaggccatcgccgaccgcgccaagcgcctcttcgccctcggctacgaccgc
gccggcgactggaaccgccgtgaggaaaccctggccgctctcgaccgcctgaccaaggcc
cgcaccggcgagatcctcgaccacgccctcggcctctccacccgccagatgcgcacctac
ctcggcttcgcccgccagcacgaggccaaggccccgcagacccccacctacaccgaccgc
cccgcctggaaacagacgcggcagttcaaataa

DBGET integrated database retrieval system