KEGG   Lacunisphaera limnophila: Verru16b_01344Help
Entry
Verru16b_01344    CDS       T04567                                 

Definition
(GenBank) L-fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
obg  Lacunisphaera limnophila
Pathway
obg00051  Fructose and mannose metabolism
obg01100  Metabolic pathways
obg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:obg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Verru16b_01344
Enzymes [BR:obg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     Verru16b_01344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AOS44283
UniProt: A0A1D8ATR3
Position
1589512..1590813
Genome map
AA seq 433 aa AA seqDB search
MRVLDVRFPTSLSLDGSDAMNPDPDYSAAYVVLTTDRVDGVEGHGLTFTIGRGNDIVAVA
IEALRPLVVGQPVAAFTSAPGAFWKHLTGDSQLRWIGPEKGVIHLATAAVVNALWDLWAK
LEGKPLWKLLSDLSPAQIVELVDWRYLTDALTPEEALAMLERLAPTRAAREAEMRRDGYP
AYTTSAGWLGYPDEKIRRLCAEGIAEGFTHFKMKVGADRADDLRRAAIFREAIGPERGFM
IDANQRWDVGVAIEWTKALAPFRPLWIEEPTSPDDVLGHAAIARALEPLGIGVATGEHCQ
NRVIFKQLLQARAIAFCQIDSCRLGGVNEVVAVLLLAAKFGIPVCPHAGGVGLCEYVQHE
SIFDYICVSGSLEQRTTEYVDHLHEHFLDPCVVKGGRYQAPLAAGTSITMKPASLAEHTY
PHGAVWQKLRKTS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtcctggacgtgcggtttcccacctcgctctcgctggacggttcggacgcgatg
aatcccgacccggattactccgcggcctacgtcgtgctcacgactgaccgggtcgacggc
gtggagggccatggcctcaccttcaccatcggtcgcggcaacgacatcgttgccgtggca
atcgaggccctgcgcccgttggtcgtggggcagccggtggcggccttcacctcggccccg
ggcgccttttggaaacacctcaccggcgactcgcagctccgctggatcgggcccgagaag
ggcgtgatccacctcgccaccgccgcggtggtcaacgcgctgtgggacctatgggccaag
ctcgagggcaagccgctctggaaactgctctccgatctctcccccgctcagatcgtggaa
ctggtggattggcgttacctgaccgacgccctcactccggaggaggccctcgccatgctg
gagcggctggcaccgacgcgcgccgcccgcgaggccgagatgcgccgggacggctatccc
gcctacacgacctcggccggctggcttggttatcccgacgagaagatccgccggctctgc
gccgagggcatcgcggagggcttcacccatttcaagatgaaggtcggcgccgaccgggct
gacgacctgcgccgcgccgccatcttccgcgaggccatcggcccggaacgcgggttcatg
atcgacgccaaccagcgctgggatgttggcgtcgcgatcgagtggaccaaggccctcgcc
ccgttccgcccgctgtggatcgaggagccgacctcgcccgacgacgttctcggccatgcc
gccatcgcccgcgcgctggagccactcggcatcggcgtcgccaccggcgagcactgccag
aaccgtgtcatcttcaagcaactcctccaagcccgcgccatcgccttctgccagattgac
tcctgccgcctcggcggcgtgaacgaggtcgtggccgtgctcttgctcgcggcgaagttc
ggcattcccgtgtgcccgcacgccggcggggtcggcctttgcgaatacgtgcagcacgag
tcgatcttcgactacatctgcgtgagcggctcgctggagcagcgcaccacggagtatgtg
gaccatctgcacgaacacttcctcgatccgtgtgtcgtgaagggcgggcgttatcaggcg
ccgctcgccgccggcaccagcatcacgatgaaacccgcgtctctcgccgagcacacctat
ccccacggggcggtgtggcagaagctgcgcaagaccagctaa

DBGET integrated database retrieval system