KEGG   Lacunisphaera limnophila: Verru16b_02510Help
Entry
Verru16b_02510    CDS       T04567                                 

Gene name
aldH
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
obg  Lacunisphaera limnophila
Pathway
obg00040  Pentose and glucuronate interconversions
obg00053  Ascorbate and aldarate metabolism
obg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Verru16b_02510 (aldH)
   00053 Ascorbate and aldarate metabolism
    Verru16b_02510 (aldH)
Enzymes [BR:obg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Verru16b_02510 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOS45429
UniProt: A0A1D8AX16
Position
2976868..2978457
Genome map
AA seq 529 aa AA seqDB search
MKPDGGSLIGFGSSGAMGASFKAFDPAKGTPIEPSFLSASAADVARAAELAAAAAPALAR
LSGAARGKFLRAIAANLETKVDDLVARAMQETALAETRLRGEVARTAGQLRLYAESAERG
DWLDARIETALPERKPLPKPDHRSMMRPLGPVVVFGSSNFPFAYSVAGGDTASALATGCP
VIVKAHPAHPGTSELTGRLILHAVRDCGLPEGTFSLLFDAGFEVGQALVQHPLIKAAGFT
GSVKGGRALTDLGAARPEPIPVYAEMGSVNPVFILPGAIGERAAGMVEGLYASAMLGVGQ
FCTNPGLIVLQRTPAAEQFVKDLAARLAATLEGVMLTPGIRKSFVAHTTARAQQPGVKVL
AQGNATSLCSAAPVWFETEAMVHMGNPSLAAEIFGPSSLVVWCKDRAEMLAVATHLEGSL
TATVHVGTEEAKDQNDLIEILATKAGRIVFNAYPTGVEVSHAMVHGGPYPATSDGGRTTS
VGTRALGRWARPVCYQGFADGLLPAELQNANPLGVWRLVNGELTKAPVG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagacggcggctccctcatcggcttcggttccagtggcgccatgggcgcttcc
ttcaaggctttcgacccggcgaaaggcacgccgatcgagccctccttcctgtcggcgagc
gccgccgacgtggcccgcgctgctgaactggcggcggccgccgcccccgcgttggcgcgc
ctgtcgggcgcggcccggggcaaattcctgcgcgccatcgcggccaacctggagaccaag
gtcgatgacctcgtggcgcgcgccatgcaggagacggcgttggccgagacccggttgcgg
ggtgaggtcgcccgcaccgccggccagttgcggctctacgccgaaagtgccgaacgcggc
gactggctcgatgcccgcatcgagaccgcgctgcccgagcgcaagccgctgcccaagccc
gatcaccggtcgatgatgcgtccgctcggcccggtcgtggtgttcggctccagtaatttt
cccttcgcctattcggtggcgggcggggacaccgcctccgccttggccacggggtgcccg
gtcatcgtcaaggcgcacccagcgcaccccggcaccagcgaactgaccggccgcctgatc
ctgcacgccgtgcgggactgcgggttgcccgagggcacgttttccctgctgttcgacgcg
ggcttcgaggtcggccaggcgctcgtgcagcacccgctcatcaaggcggccggtttcacc
ggttcggtgaagggcggccgcgccctcacggatctcggcgcggcgcggcccgagccgatt
ccggtctatgccgagatggggagcgtgaacccggttttcatcctgcccggcgccatcggc
gaacgcgcggcggggatggtcgagggcctttacgcctcggcgatgttgggcgtcggccag
ttttgcaccaatccgggattgatcgtcctgcagcgcacgccggcggcggagcaatttgtg
aaggatctggcggcgcgcctcgccgcgaccctggagggcgtgatgctcacgccgggcatc
aggaagagctttgtggcccacacgaccgcccgcgcgcagcagcccggggtcaaggttctc
gcccagggcaatgcgacctcgctgtgcagcgcggcccccgtgtggttcgagaccgaggcg
atggtccatatgggcaatccctcgctcgcggccgagattttcgggccgagttcgctggtg
gtctggtgtaaggatcgcgccgagatgctggcggtggcgacgcacctcgagggttcgctg
acggccaccgtgcacgtgggaaccgaggaggcgaaggaccagaatgacttgatcgaaatt
ctcgccaccaaggccggccggattgtgtttaacgcctatcccaccggggtggaagtcagc
catgccatggtgcacggcgggccttacccggcgaccagtgacggcgggcgcaccacgtcg
gttggcacgcgtgcgctgggccgctgggcgcggccggtctgctaccagggcttcgccgac
ggcttgctgccggccgaactgcagaacgccaaccccttgggggtctggcggctcgtgaac
ggcgaactgacgaaggcgccggtgggctga

DBGET integrated database retrieval system