KEGG   Lacunisphaera limnophila: Verru16b_03277Help
Entry
Verru16b_03277    CDS       T04567                                 

Gene name
folA
Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
obg  Lacunisphaera limnophila
Pathway
obg00670  One carbon pool by folate
obg00790  Folate biosynthesis
obg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Verru16b_03277 (folA)
   00670 One carbon pool by folate
    Verru16b_03277 (folA)
Enzymes [BR:obg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Verru16b_03277 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AOS46180
UniProt: A0A1D8AZ59
Position
3851007..3851498
Genome map
AA seq 163 aa AA seqDB search
MPHPIELIVACAENRIIGRAGRLPFDIPEDKQWFHDQTANHTVVLGRICYETWPHVRADG
RQPVVITSDRSLARPGVLVAANVPEALALAQKLPGRLLVCGGQRIYEETLPLADRLILTQ
VHAPVEGDTWFPEWRHLSWRETWKREGADRNFRYTFSVLERVR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcccatcgaactgatcgtcgcctgtgccgaaaaccgcatcatcggccgcgcc
ggccgcctcccgttcgacatcccggaggacaagcagtggttccacgaccagacggccaac
cataccgtggtcctgggccgcatctgctacgagacctggccccacgtgcgggccgacggc
cgccagccggtcgtgatcacctccgaccggtccctggcccgtcccggggtcctggtcgcg
gcgaacgtgccggaagccctggccctcgcccaaaaactgcccggacgcctgctggtgtgc
ggcggccagcggatctatgaggaaaccctgccgctcgccgaccgcctgatcctcacccag
gtccatgccccggtggaaggagacacgtggtttcccgaatggcggcacctgtcctggcgg
gaaacctggaaacgcgagggcgcggaccggaatttccgctacaccttctccgttctggaa
cgggtgcgttag

DBGET integrated database retrieval system