KEGG   Octopus bimaculoides: 106867724Help
Entry
106867724         CDS       T04127                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
obi  Octopus bimaculoides
Brite
KEGG Orthology (KO) [BR:obi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:obi01009]
    106867724
Enzymes [BR:obi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106867724
    3.1.3.48  protein-tyrosine-phosphatase
     106867724
Protein phosphatases and associated proteins [BR:obi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    106867724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase CDKN3 Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 106867724
NCBI-ProteinID: XP_014768210
UniProt: A0A0L8IHV6
Position
Un
AA seq 392 aa AA seqDB search
MPDSGEIDVLTPTLSLPERRRAGLKLEFGSLNVVSKKCKLESLSADVGLSDMSNGTLRRA
RTITTNELAGRLSSGRAKSMLIVDCRPFLEYNMSHIRGAINVNCIDRLNRKKLQQKGKVA
LVDLVTTKEGKEMFRRRSAKEIILYDTCTRDESHLSRDNALTAVLSLLYWEGKEAFILKG
GLREFKSKHENLCDNLLWMSSDCRLLSSECRLVHSPLTPLVEHQIEAAEVSRILPFLYLG
NERDAGNLQILKELDITYILNVTSHVRPHFESQGIHYKTIPVTDSGHQNLRKYFDDAIEY
IDEAKRNGAKILIHCQAGVSRSATVTIAYLLKHSTLSMTDAYRYVKQKRAIISPNFNFMG
QLMEFEQSLNNGLSPRIPEKSREEFDEIDSWL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattcaggagaaatagatgttcttacaccaacattaagtttaccagaacgaaga
agggccggattgaaacttgaattcggctctttgaatgtcgtgagcaagaaatgcaaactg
gaaagtttatcagccgatgtgggcctgtctgatatgtcgaacggtactttacgccgggcg
cgaactataaccaccaacgaactggccggacgtttgtcgtcgggtcgcgcgaaaagcatg
ctgatcgttgactgccggcccttcttggagtacaatatgtcacacatacggggcgcaatc
aacgtcaactgcatcgatcggttaaaccgcaaaaaactgcaacagaagggtaaagtggct
ctggtcgacttggtcaccacgaaagaaggcaaagagatgtttcggagacgttctgccaag
gagattatcttgtacgacacttgtacgagagatgaaagtcacttaagcagggacaatgca
ctcacagccgtcctcagtttactgtactgggaggggaaagaggcattcattttaaaaggg
ggtttacgggaattcaagtcaaaacacgaaaatctatgcgacaatttactatggatgtcg
tcagactgtcgtttgttatcgtcagagtgtcgtctggtacacagtcctttgacgccatta
gttgaacatcaaatcgaagcagccgaggtttcacgaatattgccttttctctatttaggt
aacgagcgagatgctggtaatttacaaattctgaaagagttagatataacttatatttta
aatgtcacgtcacatgttcgaccccatttcgagagtcaaggcattcattacaaaacgata
ccagtaacggacagcggtcaccaaaatctacggaagtactttgatgatgccattgaatat
atagatgaggccaaacgaaacggcgccaagatcttaatccattgtcaagccggagtatca
cggtcggcaactgtgaccatcgcatatttactgaaacactccaccctcagtatgacagat
gcttaccgatatgtcaagcaaaagcgtgcaatcatttcgccgaattttaacttcatggga
caactcatggagtttgaacaatccttaaacaacggactctcgcctagaatccctgagaaa
tcgcgggaagagtttgacgagattgacagctggttatag

DBGET integrated database retrieval system