KEGG   Octopus bimaculoides: 106869336Help
Entry
106869336         CDS       T04127                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
obi  Octopus bimaculoides
Pathway
obi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:obi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106869336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:obi04030]
    106869336
G protein-coupled receptors [BR:obi04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    106869336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 106869336
NCBI-ProteinID: XP_014770533
Position
Un
AA seq 398 aa AA seqDB search
MAMHNSPYTTWSSAMDLNQATFDLQDYPRTGMNNTFPAFNDSNKCDEILSYLAEPPPQLC
FWVKFALGFFLSCLAGLTISGNCLVIAAVLTHNHLKSYTNAFVVSLAISDTLVGGAVMPY
AIRQLMWDNHWGHGLILCRIIICLDVTFTTTSIFHLVCLAGDRYLAICRPFQHQKVKKRH
VVISIILCWTVPLLISFVPITNEWNLKGIEAIYECIAPPGSDVCIFLVNKAFAFTCSAVA
FYIPSAFLVMCNAQIYTAAKRQAKQIRTLEQAIIQNKNKRKAFKHEAKAAKTLGIIMGCF
CVCWCPFFIINVIDAIIQYQTPYYLWQVAVWLGYSNSTMNPFLFYFFNRSFRIAFRRILR
MKTNHGTVGQCDDLTTAAAGSQGSDINCRYFPAQTNGF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcacaattcaccgtatacaacttggagtagtgcgatggatctgaatcaggct
acatttgatctccaagattatcctcgaacaggaatgaataacacttttcctgctttcaat
gattcgaataaatgcgacgaaattctatcatatttggcagaaccacctccacaactatgt
ttctgggttaaatttgccctaggatttttcctcagctgcttggctggactaactatttcg
ggcaactgtttagtaattgcagcagtattaacacacaatcacttgaaaagttacacaaac
gcctttgttgtctccttagccatttcagacacgcttgttggcggcgccgttatgccctat
gccattagacagttaatgtgggataaccactggggccatggcctcattctgtgtcgtatc
atcatctgcttagatgtaacattcacaacaacctccatctttcatctggtctgtttggct
ggagatcgctatctcgcaatttgtcggccatttcagcatcagaaagtaaaaaagagacat
gtagttatttctataatcctttgttggacagtaccactgctaatttcgtttgttcctatc
accaacgaatggaatttgaaaggcatagaggcaatatatgaatgtatagctccacctggt
agtgatgtgtgtatttttcttgttaacaaagcatttgcgtttacgtgctcagctgtagcc
ttttatattccgtccgccttcctcgtaatgtgcaacgcacagatttatacagcggccaaa
agacaggcaaagcaaataaggacgcttgagcaagcaatcattcagaacaaaaacaaacga
aaagccttcaaacacgaagcaaaagctgctaaaacgttaggaataataatgggatgcttt
tgtgtttgttggtgcccatttttcattataaatgttattgatgctattatccagtaccaa
acaccctactacttatggcaggtggcggtttggctaggatatagcaactctacaatgaat
ccttttttattttatttttttaatcgatcattccgaatagcattccgtcggattctaaga
atgaaaacgaaccacggaacagtgggacaatgtgatgatttgaccactgctgcagcaggt
tctcaaggttctgacatcaattgtaggtattttccagctcaaacaaatggattttga

DBGET integrated database retrieval system