KEGG   Octopus bimaculoides: 106872182Help
Entry
106872182         CDS       T04127                                 

Definition
(RefSeq) nitrilase homolog 1-like
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
obi  Octopus bimaculoides
Brite
KEGG Orthology (KO) [BR:obi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106872182
Enzymes [BR:obi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     106872182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase HIT DcpS_C
Motif
Other DBs
NCBI-GeneID: 106872182
NCBI-ProteinID: XP_014774564
UniProt: A0A0L8H9W4
Position
Un
AA seq 472 aa AA seqDB search
MTFAVFFTHRLTRLVVRTASTGCRHHLRKMSSIVEKVGKQHPRIAVCQLTSSADKEENFS
VCRSLIEKAKSQGVQMVFLPECFDYIGESIKQSLEQSESLDGHLVSKYKGVAKELQIWLS
LGGFHQKNTDQFVKNTHIIINSDGHVVTTYEKIHMFDADIKGLSLHESDYTTPGKCIKPP
VVTPVGKVGLGICYDLRFPELALILARQGAELLTYPSAFMEPTGIAHWESLLRSRAIESQ
CYVIAAAQVGRHNKKRSSYGHAMVIDPWGSIIAECSKGIGLCTAEINMDLLHDVRLEMPV
WHHRRNDLYNQIYSFSTENTTVDEQETYKFGHIDIPSTQVFLNTPFSFAFVNIKPVLPGH
VLICPKPVVSSFSEVSDEHTSDLWCTARKVGDVVKKHFNGTSLTFAIQDGLEAGQSVKHV
HVHVIPRFAGDFSENDDIYRKLQEKPVQGKTLKLRTKEEMEAEARVLRTYFT
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacatttgccgtgttttttacacaccgcctaacgaggttagttgtccgtactgcttca
actgggtgtagacatcatttacgcaagatgtctagcattgtggaaaaagttggtaaacaa
cacccacgtatagctgtgtgccagttaacatcgtctgcggataaagaagagaacttttct
gtttgcagatcgcttattgagaaggccaaatctcaaggagtacagatggtatttttacca
gaatgttttgattatattggagaatccataaagcagtctttggaacaatctgagagtctt
gatggtcatttagtatctaaatacaagggtgttgctaaagaactacaaatatggttgtcg
ttgggtggatttcatcaaaaaaacacggaccaatttgtgaaaaatacacatattattatc
aacagtgatggccatgttgttacaacctatgaaaaaatccatatgtttgatgcagacatc
aaaggcttgagtttacatgagagtgattatacaacacctggcaaatgtattaaaccccct
gtagtgacacctgttggaaaagttggcttagggatttgttatgatttacgtttcccagaa
ttagctttgattttggccagacaaggtgcagaattattaacttatccttctgctttcatg
gaaccaactggtattgctcattgggaatcattacttcggagccgtgccattgaaagccag
tgctatgttatagcagctgcacaagttggccgacataataagaaacgctcatcgtatgga
catgcaatggtaattgatccatggggaagcattattgctgaatgtagtaaaggaataggg
ctatgtactgcagaaatcaatatggatttattacatgatgtccgattagagatgcctgtt
tggcaccacagacgtaatgacctctacaatcaaatatattctttctccactgaaaatacc
actgtagatgaacaggaaacatataaatttggtcacattgatattccttcaacacaagtg
tttcttaatacaccattttcttttgcatttgtcaacatcaaacctgtattacctggacat
gttttaatttgtccaaaaccagttgtttctagtttctctgaggtaagcgatgagcataca
tctgatttatggtgtacagcacgcaaagtcggtgatgtagtcaagaaacattttaatgga
acttctctgacttttgctattcaagatggcctagaagcaggacaaagtgttaagcatgtt
cacgttcatgtaattccaagatttgctggtgatttctcagaaaatgatgacatttacaga
aagctgcaagaaaagcctgttcaaggcaaaacattaaagcttagaactaaggaagaaatg
gaagcagaggccagagtacttcgtacttactttacgtag

DBGET integrated database retrieval system