KEGG   Octopus bimaculoides: 106873343Help
Entry
106873343         CDS       T04127                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
obi  Octopus bimaculoides
Brite
KEGG Orthology (KO) [BR:obi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:obi04040]
    106873343
Ion channels [BR:obi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106873343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin TMEM37
Motif
Other DBs
NCBI-GeneID: 106873343
NCBI-ProteinID: XP_014776155
Position
Un
AA seq 248 aa AA seqDB search
MAQTMNNQLLLTVLSFSTGAVALVTLALAVATDSWLYTEEAIDYVLENVTIVYVVRTHSG
LWRVCTINEYSPGEEESLCANIEYYKQGYERIEKASTSMAIIRAIRLSAPYPVVALLMIV
IAAITSVIGNIKADVKTLIGAIIYVFSGLALSVGIILYISAVNDEVGHRAKIIGVQGPKF
AYFYGWSFFFAGVSFITAEMAAVFGISLYLLRNSHVDDMVRIIPGLEDKVDGDNYQDNVG
IQTTTIVL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacgatgaacaaccaacttctgttgaccgtgctgtccttctcgactggggct
gtggccctggtcactctggcccttgctgtggccacagattcctggctttacacagaagag
gcgattgactatgtgttggaaaatgtcacaatagtatacgtggtcagaacacattctgga
ctttggagggtttgtacaatcaacgagtacagtcctggtgaagaagaatcgctatgtgcc
aatattgagtactacaaacaaggttatgagcggatagaaaaagctagcacgtctatggct
attatacgagccatccgactgtctgccccttacccagtggttgctcttctcatgatagtc
attgcagccatcaccagtgtcatcgggaacataaaagcagatgtgaaaacgttgataggg
gcaatcatttatgttttctcaggtctggctttgtcagttggcatcattctctacatatca
gctgtcaacgatgaggtgggacatcgagccaagatcattggtgtccaaggcccaaagttt
gcctacttctatggctggtcgttcttctttgccggagtgtccttcatcactgccgaaatg
gcagctgtgtttggcatctcactctacctgctgcgcaactcacacgtcgacgacatggtg
cgaatcataccaggcctggaggacaaggtggacggtgacaattaccaagacaatgttggc
atacagacaacgacgatcgttttatga

DBGET integrated database retrieval system