KEGG   Octopus bimaculoides: 106875475Help
Entry
106875475         CDS       T04127                                 

Definition
(RefSeq) sphingosine kinase 2-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
obi  Octopus bimaculoides
Pathway
obi00600  Sphingolipid metabolism
obi01100  Metabolic pathways
Module
obi_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106875475
Enzymes [BR:obi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     106875475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 106875475
NCBI-ProteinID: XP_014779119
Position
Un
AA seq 684 aa AA seqDB search
MASRKHCVILKTVVTIYPRKKRYLLVLRRGSLTYWPYNDNSDDDESSWFNNSTDKTAAGS
GFGGNPVAAAAAASNPVRKVSFDTNPQNYSEWNDSIRKDSDQRTPSVEPLAGARPTETTT
PATQPQPPSPLCASQETRKTPDDSQAYFTVYAYPFRRKILSGRQIRHRLSVTFGIFCQEN
FQENLRLAETWKKLIGHLARGKPINGLEDHAGHAQKIVQTLDISRWYGIVIVAGDGLIFE
VINGLMSRPDWDQALKIPIGCIPGGSGNALCCSINYSAGEPILENMVLHSTFILIKHQVL
PLDLVAIQTVNQSMYSFLSVTWGFIADIDYESEKYRKSLGSKRFLFLLAQRLIDLRSYRG
RLSFIPITAFKDSTDGEGGNVRKLSRFAFDINPGSRSSLDDSSSMDEGVTWSSSSMSTEG
NTCIKRSATMSEGCSVKAKQECSDVGSKNTRHCSETNLSFEESTRSSHRDLSFNSCSDIT
NSPYLIDDGKENNCDQMEHADSSTFRTANYSDNKAGFPLENNDSIRWKSQQMVTADNVVI
QEETLTARKNVGCPVPTPLLPPLHEPLPDNWVVIEDDFVLLSASYQTHLGPDFLSAPDSR
FNDGIIHLHFIRTGISRNALFKLFLSVEDGSHLDSPFVESIKVLAFRLEPLDKAGNIMVD
GEHIEYGPIQGQVLPGIAKIMGIQ
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgcaaacattgtgtgattctcaagaccgtcgtcactatctatccccgcaag
aagcgatatttattggtcctgaggcgggggtccctgacatattggccctacaacgataac
agtgacgacgacgaatcgtcgtggtttaacaacagcaccgacaaaacggcagctggttcg
ggttttggaggcaaccccgtcgctgctgctgctgctgcttcgaaccccgttcgcaaggtc
agcttcgatacgaacccgcagaattacagcgagtggaacgatagcataagaaaggactcc
gatcagagaaccccttcggtcgaacccttggcaggagcacggcccacggagaccacaaca
ccagcaacgcaaccccagcctccgtcaccactttgtgcctctcaggagacgaggaaaacc
ccggacgacagccaggcgtattttactgtatatgcctaccccttcagacggaaaatcctc
agcggtcggcaaatccggcacaggttgtcggtgacatttggaatattctgccaggaaaat
ttccaagagaatctgagactagccgagacatggaaaaaattaattggacatttagcacgt
gggaaaccaatcaatggacttgaagaccatgcaggccatgctcagaagatagtacaaacc
cttgacatttctcgatggtatggcatcgtgatagttgcaggagatgggctgatatttgag
gtcatcaatggactgatgtctcgccctgactgggatcaagccctcaagatcccaattggt
tgtatccctgggggttcggggaatgccttgtgttgttccatcaattactcagcaggtgaa
cctattctagagaacatggttcttcactcaacgttcatcctgatcaaacaccaagtactc
cctctcgatctggtggccatccagactgtaaaccaatccatgtactccttcttatcggtt
acctggggtttcattgcagacattgactatgagagtgaaaaatacaggaaaagccttggt
tcaaagagatttctctttctcctagcacaacggcttattgatttacgttcatatcgagga
cgtctctcatttatcccaataacagccttcaaggacagcacagatggtgagggcggaaat
gtccgcaagctgtcccgctttgcattcgacatcaacccaggtagtaggtcgagtctagac
gacagttcgagcatggacgaaggggtcacgtggtcgtcgagctccatgtcgacagagggc
aacacgtgcataaagcgctctgcaacgatgtcggaaggttgcagcgtgaaagcgaagcaa
gaatgctccgacgtcggatccaagaacacgcggcactgttccgagacgaacctctctttc
gaggaatcgacgaggagtagtcaccgagacctgagtttcaattcttgctccgacataacc
aactctccgtacctcatcgacgacggcaaagaaaacaactgcgaccagatggagcacgcg
gactcatctacattccgaaccgctaactacagcgacaacaaagcaggtttccctttagaa
aacaatgactcgattcgctggaagagccagcaaatggtgacggcagacaacgtggtaatc
caagaagagaccctaactgcgcgtaagaacgtagggtgcccagttccgacaccactgctc
cctcccttacacgaacccctccccgacaactgggttgtgatcgaagatgactttgtgcta
ttgtctgcctcgtaccagacacatttggggcctgatttcctcagcgctcccgacagccgt
ttcaacgacggtattatccatttacattttattcggactggtatttcaaggaatgcactt
ttcaaattgtttctctctgtggaggacggttcccatcttgactcacctttcgtggaatca
atcaaggtattggcgttccggctggaacctctagacaaggctgggaacattatggttgat
ggggaacatatagaatatggtccgattcagggacaggttttgcctggaattgctaaaatt
atgggtattcaataa

DBGET integrated database retrieval system