KEGG   Octopus bimaculoides: 106875964Help
Entry
106875964         CDS       T04127                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
obi  Octopus bimaculoides
Brite
KEGG Orthology (KO) [BR:obi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:obi03016]
    106875964
Enzymes [BR:obi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     106875964
Transfer RNA biogenesis [BR:obi03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    106875964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 106875964
NCBI-ProteinID: XP_014779790
UniProt: A0A0L8GM30
Position
Un
AA seq 201 aa AA seqDB search
MAKSFALQKKNNLSKIDCSRKGSIDAPILSLCQYINSLEQYFTTSSCSGRIIIFEDAESD
GVKKKGCRWLFTTHELVHLEDTVAPLEEITGDAVFKFEPFVMHIQCRELHDAQTIHAVSV
ASGFRNSGITVNRKGKIIAAIRSTQCLEVPLSNNGELLVSKEYIDYIIGIANQKMSENLT
RIQRLFENLQEANLKNSGSHI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatcattcgcgcttcaaaaaaagaacaatctttctaaaatagactgcagccga
aagggatctattgatgcgcccatcttatctctttgccaatatatcaattccctagaacaa
tacttcacaacaagttcttgttctggcagaattataatattcgaagatgctgaatctgat
ggagtgaagaagaaaggctgtcgatggctttttacaactcatgagctggtccatcttgag
gatactgtagcaccactagaagaaataactggggatgctgtttttaaatttgaacccttt
gtgatgcatatacaatgccgagaattacatgatgctcaaacaattcatgctgtgtctgtc
gcttctggatttcgcaactctggtattacagtcaacagaaaggggaagattattgctgca
ataagaagcactcagtgtttagaagtaccattatcaaataatggtgaactccttgtttcc
aaagagtatattgattatatcattggaattgcaaaccaaaagatgagtgaaaacttaaca
cgaattcaaaggttatttgagaacctacaagaagcaaaccttaaaaattctggatctcac
atttga

DBGET integrated database retrieval system