KEGG   Octopus bimaculoides: 106877831Help
Entry
106877831         CDS       T04127                                 

Definition
(RefSeq) uncharacterized LOC106877831
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
obi  Octopus bimaculoides
Pathway
obi00230  Purine metabolism
obi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106877831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obi01001]
    106877831
Enzymes [BR:obi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106877831
Protein kinases [BR:obi01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   106877831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor EGF_2 HNOBA
Motif
Other DBs
NCBI-GeneID: 106877831
NCBI-ProteinID: XP_014782344
UniProt: A0A0L8GDD7
Position
Un
AA seq 1683 aa AA seqDB search
MFSLERTHYYSSHIFLFYLLLLVTAQQYSLRLDEHNSPPDVIPTSPYNLKYSVPLNELTS
YPIFAYFYRLDGSEVKDGSLNDQEVTVTSRSTTNVDSWRMSGGKLCQNTNPDVFLPMRYN
RHTYVKKCGSTIGPTTLKVKVFNGTIIIDWLMHSHERYLVPDIDRIYRIDVPGLSIRIDT
YPFRITTPAAKLVITKHPPSNIQANTGFNVTAEIHDNVGKVITSGLDSIAFVELTVPYRY
KEFYYRRNLDMMLKHTDIRLAGSSTMIHQSTNDIIIRKQAVAGKVIFEDIRILDVVVGFR
LNLTMYMARDPWIRIPNCKTCYDDLSRKNIYESENYVKFFDLSDSILAGIPAMAFTKPIN
VEAQRLASLQIIHNLKSTSSSIKITRNFPIPGEMKIMIIDVNGNRIYSGPDSKINIDVKT
TPPNICLSTDMTKTIIDGLVELRGSICSISSSVRLIISSTSHAGVSVQTPIFTVIGLVHI
GHIGDFNTAGTIKSPYPHIDTFVKFAAADISWGGIPGIFEQYGMSIAVESINTNDEIEFT
VQQYQMYKETHQNSESELRGILLSASSLVTKAVARNSMIDNIPVIALTEKDNSFLRYNLF
NKICWGWPEIYSFFLKACKDRRWLQMSSISSSEKSVDIEFFNSAQIFDVKITMPVIVPEF
DSYSDSPWQPEFYGEAMRFLKDAGTKIIICFATRSLPYILRSGIRFGISALDGYQWLFIS
ENARSFPLMNEAVCQWEPKCTHAYRGSLLFIETYDFGNFQTERWLHTLERFYSIDRTEYL
GSKAIYPNEELASYLALGYDAMWLLAQAISNIVSRQKTAFGDEISNELKKINLNGLSGKV
RLDESGKRSDFMGSIILINPIGNVSESHPNLVALPIRLILWKDSGEIELNYQAKYPLNKP
PYNYVLPPMSLPVADTYNIRTYHSVSGMISEHENKLIEAPNEPWPSISFERTEKLVTPFR
CKQNCGDLISEDDVTVFNNGVCIAENVCVCNKGYLGDGCINVSCSCVHGGCSSPDICTCK
SGWKGSRCDQPVCNTPCKHGKCVKPDKCQCESSMWLGKYCSIHLAAILVPVICSLVLLIC
FIYLLIRYLIKRIQLRTALANLEWLVIWDEAVKIDSQEKDTKNVSTATHVSRMFNDLYTW
KREKWFVKRFNCRTIDLDDEAVRLEMVELTTLNHKNLIIYGGACLTYPNVSFFLEPANKG
SLEDILINDAIQLGWDFRFSFLKDICCGMDFIHSKTNIGSHGRLKSSNCLLDNRWCIRLS
GFGCPSIRYGQYLMAGEEKDWQTELLKMNELFWTAPELLITVECLNDVQMGTKEGDIYSF
GIIASEIATRDIPFAYERMFLSVSAILDLIVEKDSPLLEEERKVWQSIGGDIFVIRPQLK
SEHLPEGKTTQRKFLKMLEDVWNDEPLLRPPFSKLLAVLDNIHPTKGELMDNLIRLLESY
SNNLEQVVIERTHDLEVEKAKIDHIISQMLPKKVVEELKHGNKVEPEDFSCVTVFYSDIV
GFTTIAKNSQPMQVVDLLNNLYSTFDSILHKYDVYKVETIGDAYVVASGVPERNGNAHAG
EITTAAMDLVITMLAMKVPHLPDCKLLLRIGAHSGPVVAGVVGLKMPRYTLFGDTMLIAA
TMESTSEPLRIQLSEHTVKILDQLGGYETELRGEMTVAGRALTTFWLISKDGYEGTLPQV
VCQ
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atgttctccttggagcgtactcattattatagcagtcacatcttcctgttttatctactg
ctgttggttaccgcacaacagtatagtcttcgattggacgaacacaactcgcctcctgac
gttatacctactagtccatacaacttgaagtactcagtaccattaaatgaactgactagt
tatccaatttttgcctatttttataggttggatggaagtgaagttaaggatggttctcta
aacgatcaagaagtaacagtgaccagtaggagtactacgaacgttgacagctggagaatg
tccggtggtaagctatgtcaaaatactaatcctgatgtatttctacccatgagatataat
cgccacacatatgtcaagaaatgtggctcgacaatcggaccgaccacattaaaagtgaaa
gtattcaatggaaccattataatcgattggcttatgcattctcacgaaaggtatttagtg
ccagacatcgaccgaatatatagaatcgatgtccctggtctatctattcggatagacacg
tatcctttccgtataaccactcctgctgctaaactcgtcatcaccaaacacccaccgtca
aacatccaagccaacacaggttttaatgttacggccgagatacatgataatgtaggtaaa
gttattacgtcgggtctagactccatcgcttttgtagagttgactgtaccatatcgctat
aaagaattttattatcgaaggaatttagacatgatgttgaaacacactgacatccgattg
gcaggcagttcgaccatgatacaccaaagtaccaatgatataattatacgaaaacaagcc
gtagcaggtaaagttatattcgaagacattcggattttagatgttgtagtcggctttcgc
ttgaatttaactatgtatatggcgagagatccatggatcagaataccgaactgtaaaact
tgctatgatgatttaagtcgtaaaaacatttatgaatccgaaaactatgttaaatttttt
gatttatccgacagcattcttgcaggaattccagctatggcttttacgaaacctattaat
gttgaagcccagagacttgcaagtttacaaattattcacaatttaaaatcaaccagttca
tctatcaaaattactcgaaattttcctattccaggagaaatgaaaataatgattatagat
gttaatgggaatagaatttactctggtccagattccaagataaacatcgatgttaaaacg
acccccccgaatatatgcctttcaacggacatgacaaaaacgataatagatggcttggtg
gaactaagaggttcaatatgttcaatttctagttcggtgaggttgataatttcctcaact
tcacatgcaggtgtaagcgttcaaactccaatttttactgtgattggtctagttcatata
gggcacattggggatttcaatacagctggaacgattaaaagtccttatccacatatagat
acttttgtaaaattcgctgctgctgacataagctggggcgggattcctggaatttttgaa
cagtatggtatgtcaattgcagttgaatcaatcaacactaatgatgaaatagaatttact
gttcagcagtaccaaatgtataaagaaacacatcaaaatagcgaatcggaattgagaggt
atccttctgtcagcaagttcattggttacaaaagccgtagccagaaactcaatgatagac
aacattccggtcattgcattgactgagaaagataattcttttctgcgatacaatttattc
aataaaatttgctggggatggccagaaatttacagtttttttctgaaagcttgtaaagat
agaagatggctccagatgtcatctatcagctccagcgaaaagtctgttgatattgaattc
ttcaacagtgcacaaatattcgacgttaagatcacaatgccagtgatcgtcccagaattc
gactcttacagcgattccccttggcaaccagaattttatggtgaagcaatgagatttcta
aaggatgccgggacaaaaataattatttgttttgccactcgctctttaccatacattttg
cgttctggaatccgatttggtatttctgcacttgatggttatcagtggctttttataagt
gaaaatgctcgatcctttcctttaatgaacgaagccgtctgtcaatgggaaccgaaatgt
acccatgcttatcgtgggtcactactattcatagaaacttacgattttggaaacttccag
acagaaagatggctacatacactcgaaagattttatagtattgacagaacagagtattta
ggaagtaaagcaatatatccaaatgaagaactagcatcttatttggcactgggttatgat
gccatgtggttgttggctcaagcaatcagcaacatagtttccagacaaaagaccgctttt
ggagatgaaatttcaaacgaactgaaaaaaattaatttgaatggactgtcaggaaaggtg
cgtctcgatgagagcggtaaaagatctgactttatgggaagtatcattttgattaatccc
atcggcaatgtttctgaatcccaccctaatttagtagccctcccgataagacttatacta
tggaaagattctggtgaaatagagttgaattaccaagctaaatacccattgaataagcct
ccatataattatgtactaccaccaatgtcgcttcccgtggctgatacgtacaatattaga
acatatcattcagtttcaggaatgattagcgagcatgaaaataaattaattgaagctcca
aacgaaccatggccatctataagctttgaacggacggagaagttagtaacaccttttagg
tgtaaacaaaactgtggtgatcttatatcggaagacgatgttacagtcttcaataatggt
gtctgcattgcggagaacgtgtgtgtgtgtaacaaaggatatttaggagatggatgtatt
aatgtttcatgcagttgcgttcatggcggatgtagctcgccagacatatgtacctgtaaa
tcgggctggaaagggtcgcgctgtgaccaaccggtatgtaacactccttgcaagcatgga
aaatgcgtgaagcccgataaatgccagtgtgaatcatcaatgtggctcggtaaatattgc
tcaatacaccttgcagccattctcgttccagttatttgttctctggtgttgctcatatgt
tttatatatctattgataaggtatttaatcaaacgcatccaactcagaactgcactggca
aatctcgagtggctcgttatctgggacgaagctgttaaaatcgattctcaagaaaaagat
acgaagaacgtttcaactgcgacccatgttagtcgaatgtttaatgacttgtacacgtgg
aagcgtgagaaatggtttgtgaaacgcttcaactgtagaaccattgaccttgatgatgaa
gcggtccgactagaaatggttgaactgacgactttgaatcacaaaaatttaatcatttac
ggtggagcctgtctcacatatccaaacgtgtctttttttcttgagccagcgaataagggc
agtcttgaagatattcttatcaatgatgctatacaacttggttgggatttccgattttct
tttctaaaagacatctgctgtggaatggatttcattcacagtaaaactaatattggctct
catggacgtctcaaatcatcgaattgtttacttgataaccgctggtgcattcgtttgtcc
ggttttggctgtccatcaattcgctatggacagtaccttatggctggagaagagaaagat
tggcagactgaattattaaagatgaacgaacttttttggacggctcctgaactactaata
actgttgagtgtctaaatgatgttcagatgggtactaaagaaggggatatttattcattt
ggaataattgcttctgaaattgccacccgagacataccgttcgcttatgaacggatgttc
ctatctgtaagcgctattttggatctcatagtggagaaagacagtcctcttctagaagag
gagagaaaagtatggcagtcaattggaggcgatatatttgttattcggccacaacttaaa
agcgagcatttgcctgaagggaaaacaactcagagaaaatttctcaaaatgcttgaagac
gtatggaacgatgaacctctgctcagacctccattttcaaagcttcttgcagtgttagat
aatattcatccgacaaagggagaactaatggacaacttaattcgactattggaatcttat
tccaataatcttgaacaagtggtgattgagcgcacccacgacctcgaagtagaaaaggca
aaaattgatcatattataagtcaaatgttgcccaagaaagtggtagaggaattaaaacac
ggaaataaagtggaaccagaagacttcagctgtgtcactgtattctatagtgatatagtc
ggatttacaacgatcgcgaaaaacagccagcctatgcaagtggttgatctgttgaacaac
ctctacagtacattcgattctatactgcacaaatatgacgtctacaaagtggaaactatc
ggagatgcctatgttgttgcaagtggcgtccccgaacgaaatggaaatgctcatgcaggt
gaaattacgacagcagcgatggacttagtcataaccatgttggcaatgaaagtaccgcat
ttacccgactgtaaacttctgttgcgtatcggcgctcactctggaccagttgttgccgga
gttgttggtttaaagatgcctcgctacaccctttttggcgacacaatgttaattgcagcc
acgatggaatcgacttcagaacctttgcgtattcagcttagtgaacacacagtaaaaatt
cttgatcaactcggaggatatgaaactgagctacgcggagaaatgactgttgctggacgt
gctctaacaacattctggctgataagtaaagacggatacgaaggaactcttcctcaggtt
gtgtgtcaataa

DBGET integrated database retrieval system