KEGG   Octopus bimaculoides: 106879158Help
Entry
106879158         CDS       T04127                                 

Definition
(RefSeq) epididymal secretory glutathione peroxidase-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
obi  Octopus bimaculoides
Pathway
obi00480  Glutathione metabolism
obi00590  Arachidonic acid metabolism
obi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106879158
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106879158
Enzymes [BR:obi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106879158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 106879158
NCBI-ProteinID: XP_014784083
Position
Un
AA seq 247 aa AA seqDB search
MMVGSLTASMEPSKLMFLSHLLASFLSIYLCEGFTITASLTEEMTTRQNHVHNRGHIHGH
LKLHRSTNFLTCYQSDNHSTSLYDYKSYDIHGAEEIPLSVYRDKVLLIVNVASFUGATPQ
YLGMNALEKEFKDFHILGFPCNQFWLVSRPHTFFHFFISCIGKFCENVTGVQILLFLFQS
YCPSPKQDFASVERLHYKPMSANDIRWNFEKFLINRKGKPVMRFATAVLPNEIRPYIVHL
LEEKEEF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcggatcgctaactgcaagcatggaaccatccaagctgatgtttctgtcgcat
ctgttggcaagtttcttgtcgatttacctgtgtgaaggctttaccatcaccgctagtctc
accgaggaaatgaccacacgtcagaaccacgtccacaatcgtggtcacatccacgggcac
ctgaaacttcacaggagcaccaacttcctcacctgttaccaatctgacaaccacagcacg
tctctctacgattacaaatcgtacgacatccacggggccgaggaaatacctctgtcagtt
tacagggataaggtactgcttatcgtgaatgtagccagtttctgaggggcaactccccaa
tatttaggaatgaatgcactagaaaaagaatttaaagattttcatattttaggatttcca
tgtaaccaattctggttggtgagtagaccacacactttttttcattttttcatttcatgc
attggaaaattttgcgaaaatgttacaggtgttcaaattcttttatttctttttcagtct
tattgccccagccctaaacaggacttcgcttccgtcgaacggctccactacaaaccaatg
agtgccaatgacatccgatggaatttcgagaagttcttaatcaaccgtaaaggaaaacca
gtcatgcgtttcgcaacagctgtgctccctaatgaaattcggccatacatcgttcatctt
ctagaagagaaagaagaattttaa

DBGET integrated database retrieval system