KEGG   Octopus bimaculoides: 106879228Help
Entry
106879228         CDS       T04127                                 

Definition
(RefSeq) titin-like
Organism
obi  Octopus bimaculoides
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Izumo-Ig C1-set Ig_6 Spectrin DUF4198 DUF4871
Motif
Other DBs
NCBI-GeneID: 106879228
NCBI-ProteinID: XP_014784194
Position
Un
AA seq 7355 aa AA seqDB search
MDLPRNSTALAEEHTKLFNTIVEVSTAALHEGRILLERVSRDDSGANGVRQKYAELQECC
ARVESNCKAQQAEAWEKNQAYLKFQEQYKNLHAWLTQIGLATLSRHKDLGSSLANAKDFL
EIHQQLNEDVRGKATDMQALSDATDALVQSGDQEGKAAKEMYEALYQQWLKIQHIISLRI
ELSLIFVSFHKIIQNLAASSGIFENILKSETEDLQDITEDAVKNLQEMWSQTIKIHNDLQ
EKGSGFLQKTSQVTEDSNLDVAQSVTLVQKILTEYRSHITTLTEQWEIWQQRVSSSQQFK
VQWHQFIQEVRKTITSITNIEKELFMPHISGQVSENKQTAEQLQKKLEDYEPILKEAEEK
IKEHINTAETLSSKGDTKGQKDQIVNELVKVHQRFQARVTEYHFLLKMTIQFFGSLNQLD
ELINKTEQEFSTTELPSDLNQAERMLEEHKVKKSEVNQLLTHTADEGEKIVVRVRQQGAD
AATQAEIKRIMEISENYKRRWNQTWEEQDRRLAQNLQICQFNFDLRQIHSEIDELHHHLQ
ARRGNYGNNLPAARMTSQAFKQFEMTVELIEKKINSFISTAELMVQDKHYDSVHIHQEID
VLKKKWSTFHTSVTDYRSLLDISVMYFQMIEETEQWVREGNQMLINIGRQATECRQPSDA
TTLIIKLQKFVENEKPIIEQKVNKISELSHELYGDQGANKVRHVVVSYQDLLQSFQQADN
ELSALKVKLEGNEASGVEEHIPMQIDIPVNEQAVVLKPPRITQHLKNAEVLEGTKFIFEC
HIESDEIPEVKWFKDNLPLTSPDYETRFENGVATLTIEETFSEDTARYTCRVTNQAGTAE
SSAHLNVKETHQQIIPPDIIKNLKSADILEGSPFTFECQITGMPTPSISWYKDDQNIDNS
PDFVITKINGTCCLKIRKVTMQEGARYTCRANNAGGEASSSARLTVKPLEKPIIHEPLMN
RTITEGKSISFRIVFSGVPNPEVLWFRGTEQMINSNVFKISTEHNISILDIMEAYPEDSG
PYSVLVQNPAGEARSSCQLTIEQIYSSTGEEMSQSSTDVEPVKPFFSQLLQATAEVIEGS
RVRLDCIIVGNPEPEVIWYHNDKPVKESKDIQLLFEGDRCTLVIREVYLEDAGLYRCVAR
NPHGVAESHCKLIVEALSEMSDGSGTDLVAPTFPELLTDVASKPGENVTLRCTVHGMPIP
EVQWFREGILIEPSSKYKTVCNGDVHSLIIPETFGEDSGTFMVKAVNPAGEAKCYGKLLV
KSEKQPGMEQLTMVRRTVEKVTTVTRTEEIKQSPPEFTKLFQDVTVKQGEPVMLECIITG
TPKPKVVWQYNGDLIDIRQHQPCMEGDKYRLIIPKASERDAGRFTITAENPSGRATCSAR
VIVEKVLPVPMEASYQSQFTRTVTQSETRLSRIIADMQEKSMSGMEHHSTTITTQVPPKF
EVMGAPVATHDRFATSITTDLAPQYQQVDLRIEVPIPPKFLQALKNITALEGTKVTFDGV
VTGKPEPSIKWYKKDKEITDGADFEISYKDGRVSLTIPEVLEEQSGQVTCTASNYVGCAS
STAELIVRASMIPPSFTERLQRRQVKEGESVKLTVRVAGTPAPQVMWYREGSRIVSSPDF
EIIQEGDIHTLYIPEVFYEDSGKFTVKAKNPAGEAECMAELRVQAPPPPVVESFAHIKPV
VPTHQADVYMRPVEPPQPIQEPVHPSPIRHVQAPVPKPVPKPAQEPALKPTHKEKPEKPS
PIKSVQPPVPVPPADIKMDVDEPEQTLPPFEKRLKLFDQPAEVQEPVIPAAVKPQMKPAP
HLKPSFPKPLQNVTVNEGEKVIFEVIITGNPEPVVKWFKNEKIIHNSPDFEITYINGVSR
LVIAEVFAEDSGQYKCVATNVQGTNTSTAYLDVKEPISSSEESPPVSANVPQELPVLTPV
PVVQVPTASPILGVRKVPFKIPSPAPVPKPPPPPPVAEEPFLEPKKKPTVKFGAPVTQPP
RFIEPLQNAMLIEGINVMLECTVIGKPFPQIMWTHFGLPVIEDENHHVYTDVVTGRCTFL
ISKSTLRDKGDYTCTAQNIAGQDATSAVLVEAPSVPKLIDGIDHAPKKPVPKPEHVPVKK
VDDKLAKPAPQDFKSSAFEERLKQEIQFREGKIHFTSDVGSTSEYDSEHPEDKVSVGKEH
PRITQTLKNFRLIEGSDVTFVCKVTGKPRPKIAWYKNGVRMKRSGRCDMKYTHDGYCTLK
IRLAIPEDAGHYTVLAVNSTGRDTCSAELYVDSVGTIDATSFVEPETLERMLKRDQDKIN
QSAGGGGVFEKASKPAFQVIPENQEARDGQTVRFDCLVTGRPYPEISWYKNEIEMRSDDY
HKVVVNENGIHSLIILSATRQDHGQYRCVARNKAGEAVFFVTLNVMERQEIHPPHFVERL
QNYNAKENQTVTLTCTAVGCPLPMMSWQKDARMLSSKDYDISTENGRSTLTIKNATPADS
AWFQCSAVNVAGSALTRARLNVIGKGPQQPITTPEAPMFGVRRSTSPEEIPAPIDEMVVC
APAPTTETPVDGQPTEDEPAFKPPSVAEAKLIFDQSGKPLPPPATLPRVQPKPEFIPKPV
PKPAPVQEKLISPDKKVKPVKAPVPVPVPVPAESTLPRGDSPPSYEIQEEGPVQQISYAS
EIGSAVLKIVDQVDIMRDEDKPVRKPTPAPELTKPSKVEPYTAPKPAPVPEPKPAPIIPA
PPVIKHVESPKLSKKPVQPPAAPKPPPITPVAKVPVAKPPQRKRSPKPVTDNEKVANANV
KTPWNAANSEVYKALMEEKTARVSHDDLFKMEAEIQLQKMKQESHIRRRSVHPTEIIYNK
SKKKRPVFRTQLKDVEVAEYDRTHLECLLTPINDPTMKVEWLRNGQPLPYGHRYRPVYEF
GYVVLDLLFTIPEDSGIYSIKATNAYGEATINAEVVCLNKTSIIIGTQLPEGQEAIARLR
QLESYKNISLMVGNYAEDADIPSEPAPPIIEIKPEPVEIDEGETAKFIVNVSGYPRPRVT
WWINGSLVAGGSRFKVRYDGVIHYLEIPRVREYDAGQIRVLAKNQQGEAECITTLKVIPK
EDWRSHLRHAPKSDLQIELERRKRVELRSAELKMAQMKSSLASFELGMLKHETTFRKDTT
DANLQKLLAQDALRQQLIDEQYERIQKTSTQTITFKQPVKQEPPVFGIPLCPVKVLEGTS
VTLKVHFTSNPPPIITWYRDSIEIHNSWDFQIRVTETCSTLHISEVFPEDSGMYTVKAYN
KYGMTQCKAKMTVMEEEEAAKETSPEFRNLLRDTKVVVGEPATFDCEVIGKPKPKVHWQK
DGKNMPESPRWKFIHEENHYTLLIFEVQPEDAGTYACVSINTNGKSTCTAKLIVDEPDVT
KESHAHLKLAKQVKATPPTIMKRPENKTVPESESVSFSCKITSNPPPVVTWYCNNHLVKP
SKYFNMTSTPDGVHTLTLLEAFPEDRGQYRCVARNVTGEISCVCYLNVIGLESETEPETP
EVPVSPPSFIKPISNIVIEEGYPTYFEAVFTGEPDPEITWLRNGKKIKNTRDFKIERVGQ
TTILSIREAFPEDSGLITCRARNSAGVAECSAEFYVQEEQELPEDKVSRAGMKLVQPKIP
VFKRSLSQTYKVKRGQIARLEAQVEAYPPPLVKWYVNGVEILPSDHYQMFQEGDTVVLII
IHVDEKDIGEYVLRVGNELGEITCRTTITFDEKQKVVQIPDEPDSVTIKMIEKEEKTITT
EIREIRPIFVEPIQPEVFVRERGIARLECSVDAHPPPLITWYINGMEIKPSPHYEIFYES
GKSLLIIIDVGPEDTGEYTCRAVSELGEAVCSTTLYVQEPAAEMSPPPETEEEPPVEDFM
PPNFIKDLETMDVVDGQEIKMICKVVGKPVPHVSWFHNGTNIDNNDEYVISYNPETGDIC
LHIVEALPEDRGDYVCMAINQYGQAATSARLTVHEPKKEEVIIPVQKKDQKAKPAAIPPE
FVEPLQPQTVQDGSQVVLTCRMNAYPEPKITWYKDSIEIVPNNDFQITFEIETGRCKLII
TEVYPEDAGEYTCHARNIYGESVTSTTVIVETSITTTETTTKSMTTIPLDESIKLVDEHY
ITSIQMSPHYIEPTEVYHGKPVRLICQLTGEPNVSWYINEVEVRPTPNRKMFIEHNTSIL
LIVNATYEDTGEYICRMENKEGVSISRASINVMKQIEAPLTEPAAPEFTELLQPYTVHDG
DRAEFRVRFTGQPLPKITWFYDGKVITSTNDIQITVDYERKESILIIVEVFPEDEGEYTC
SASNEYGETITTCKLTVTSSSGSEAIESDETHKQTIIVDQPQIVELPDETVYQEHVEFQC
DDRRESETDLFYDAPEEVTQTEEIRTISTTTSYFEQTEEVPADVKATEKHTTTLTVDQKE
KSTPVELRFQVSEPVTETRTEIHESTHITSEEIPAKDDVVIERENIHKETIEILHKEQPE
SEPAVLSQKEIQPVLQPQRIEVEVKEHVMKMKSPEVQVVLLPDTVDAPVSEAVEIPAQTD
VPLEVVEIPAQTDVPVVKAVEILAQADVLVGEAVEIPTQTDVPAVEAVEIPAQTDVPLEV
VEIPAQTDVPVVKAVEILAQADVLVGEAVEIPTQTDVPAVEAVEIPTQTDVPVEVVEMPA
QTDVPVVEIVEIPAQTDAPVVEVVEIHAQIDKPVVVEVAEIPAQTVDMVSVSRETIVLKK
EEQPVVEEVIKEEITEKEKPVEKEVVEKAGKAPIFTWHLTSLKVMDGEEVKFYCEIDGQP
MPEIVWYHEEVPISENQDFKSIYNKETGSCSLLISEVFPQDAGEYKCEATNALGTAVSRA
YLEIESYEYIPDSEEASSQEAPSPRPVLEETELKQLSYEEVKKLIQEETSVAEVSTELPG
TSVVEKQYHTAKTVEMVLTGEAESTTDISQKQIAEFQVTSQIIKDSIQKADIESPISARA
ASQIQIPDQSQLSELQSVSEEQVKSESVISVSQQHEAGFATETKVVEKVEDLEQPQIFDF
EQKIETPVTRDIVQVEEKVEQLLAEESKVSLETVSVDQPQVFHIVSSTEEQTTIESVPGV
TKEAEKRQPTVAKSVTMKEVTEESIVTELHELPEATTDIEEITLDIHKVEEKHAKESKVL
VEMESLEQPEVVSIDGKVQEQTHIQKIVSVTKEAEKQQPTVAKSAVIKEVTEGSVVTELQ
EFPEETTDVQEITLDIHKVEEKYAKETKVSVEMESFEQPEVFAIDGKVEEQTNVASIPGV
TFEVEKQQPTVAKSVVMKELTEESVVTQLHELPEETTEMEEITLDVRTVEEKHAKESIVA
VGLERVEQPEVFDIDSKVQEQTTSSEVQVIAETSAIDSPVISKSTLLSEDVPENVVTHVK
ELDQETTLGQEIVSIVHETDQLLPKETKVDIETVAIEHPDVFSISESVEEKTTVQEIDKV
ITETIEKHLPTAAKTVAMQELIDEATASDVQEEVEEKTVPDEVSSIREQYMQNLPVESKA
AVEIELIEHPEILNLPEKTEYKPSTQEIKQVTTKPEKTYPTSAKAFALEEMTEHATTMDL
EEAPVETLKSEGVTSFQIQYEQRVERETQAAPDESIIEVPEVVNVAEKVEQKLSSAEMKV
VKEMAEKSMPIMSKSVTLEEFTESSSIISLDEETSSQPVVEEVTAPEETTGHISPKTAKS
VVLEEIFEIPEVKQLEENKTESMEKPSSVQDLDVKYKPSDAFLTQTVPLEEVVEELKTYE
LTREVEKQTDEREVSPLSNVCAPLAPSESKADVTEELLEPSVIDNVKQQDTMNLSVIGVE
LDTQSVKTQPITETTTRSVVEAFEQPNLTEVTLPSTETAIAKDMPIETLQAQYEEVPEIL
ETFVENLVTEVISETVEESKMPSFEVSLKDITVVENHVLHMEVFVSGTPMPEVKWYLNQV
ELAPSPGVHIRQEGYRSEYIVEEVFPEDQGLYSVIATNEFGTVTSSAYITVLSASGPSSD
VEIEEEQKEVTKTFVEEISIDAKPVMEQVNIEIIDKTYGIQKGESFESEETFEECIEGQA
VSDDSGEDHFEECYQDDYVESEIVPDVRKEEHIERETIVQKVGIQIQPAEVSNFKTEVVL
SPEVKKEEIKFTVSPEQVFKEEVKIATEPSNFVDTITINVDAQKEIVKEIVKTEMTKDVA
VESSFKNVLMLEPTNILVDVDEPDTIPSETMQIHFVQESKETVSEEKSLRFSTDFENIQP
ETSENLAINKAEITAKSEVCINEILDHLTMEKSENVIAEASPVEMIVENIESDIRVIQSV
EKPVQNVELIPEVIAAENADAVYQEPTPVEPTPEVIESKGVEQHVITEKHIQNVAVLPED
LPVENVDIFPREPSPVETTPEVIESKGVEQHVITEKHIQNVAVLPEDLPVENVYIFPREP
SPVETTPEVIESKGVEQHVVTEKHVQNVAVLPEVLPAENVDIFPREPSPVETTPEVIESK
GVEQHMVTEKHVQNVAVLPEVLPAENVYIFPREPSPVETTPEVIESKGVEKHMVTEKHVQ
NVAVLPEDLPTENVDIFPREPSPVETTSEVIESKGVEQHMVTEKHVQNVTVLPEDLAPEN
VEAFPREPSPVEVQSELIESGSKDTHELSEKLEINVEGSSEDTILDLLVVVPREESPVGT
TFDYDTTETTKEQVLIVQKEIKVDELPDTTVIESSHDVIKEVCAVEPVAEIVPSSASQKP
FITQGSICAEEIPQETEIDKLIIIPREIPTSAEIQIAEITDMVIPTVSEEINVYEDKPVE
VEEESFEDAAEPSDEEKESLEDFKECIDITVEPEISAVKKEIIETTRDKTSKVMVQIKPK
EEKAEKTISVTNLVQHEVTLAEHVPVVMQVEEKYKVDKTIPVTSPKKSGIKINVSENIQK
DISISEASLFKESVNVVTKPQLEEIHMEIVPEKKVDVKETVEIVRKVTEERIPERKEEPV
DKIAVFKEAVEISPKPGFQEVHMTIVPEKKVEVKETVKVVQKVKEEITPKKKEEPVDETA
VFKEGLVIAPKPTFEEVHMTIVPEKKVDVNETIHIVQKVTEQITPERREEPVDETAIFKE
GLEITPKPKFEEVHMTIVSKEKDIPVERKPEMHIEVRTVPEQLNVTQKETYSIETIASHP
KEPEFEKEIRIIKKDSTSEIVKQKSEYIQKTIDISEIHKKSTKLEVIKEFHDISVREKDT
FILEIIFEAHPAPSITWYFEDVVIESTEEFLIVIEENRTMIVVKQAILEDEGEYKVRIEN
DAGSYVSTAYVTVLPLSISDTEFETQRAVVSEQEKMEIKQEFHKFEINIDVSSRGAPPKP
EPLPVAEVKPLLERTETTTIITEQKVETVTESTTKKETTEAAPSEGGEPTNVGDASMQTF
LLAMIMVMMFIRFMAWLLSFGCCFWCCFFCCLWQS
NT seq 22068 nt NT seq  +upstreamnt  +downstreamnt
atggacttaccaaggaatagcacagctcttgcagaagagcataccaaattatttaacacc
attgtggaagtatccactgcagcccttcacgagggtcgtatcctacttgagagggtcagt
agggacgattctggggctaatggagttagacaaaagtatgctgaactgcaagaatgttgt
gctcgagttgaatcaaactgtaaggctcaacaggccgaagcctgggagaagaatcaagcc
tatctgaagttccaagaacaatacaaaaacttacatgcttggttaacacagataggcctg
gctactctcagtcggcataaggatttgggttcaagccttgcaaatgcaaaggatttctta
gaaatccatcaacaattaaatgaagatgtcaggggcaaggctactgacatgcaggcctta
tctgatgctactgacgctttggttcagtcaggggaccaagagggtaaagcagcaaaggaa
atgtatgaggcattgtatcaacagtggttgaaaatccaacacatcatcagtcttcgcatt
gaattgtccctcatctttgtttcatttcataagatcatacaaaatcttgccgcttcttct
ggaatctttgaaaacatattaaaatcagaaacagaagacttacaagatattacagaagat
gcggtgaaaaacttgcaggaaatgtggtcacaaactattaaaatccacaatgacttgcaa
gaaaaaggaagtggattcctacaaaaaacttcccaggttactgaagactcaaacttagat
gttgcccaatcagtaaccttggtacaaaaaatactaactgaatatcgcagccatataact
acccttactgaacaatgggagatatggcagcaacgtgtctcttccagtcaacaatttaaa
gttcaatggcatcaatttatccaagaagttagaaagactataacttcaattacaaacatt
gaaaaagaactgtttatgccccatatatctggtcaagtgagtgaaaacaaacagacagct
gaacagttacaaaagaaattagaagactatgaaccgatattaaaggaagctgaagagaaa
ataaaagaacatataaacacagctgaaacgttgtcttcaaaaggagacacaaaagggcag
aaggaccaaattgtaaatgaattggtcaaggtgcaccaacgcttccaggctagagttact
gaataccatttcttactaaaaatgaccatacagttctttggatcccttaatcagcttgat
gaactcataaacaaaactgaacaagagttctcaactactgaactgccatctgaccttaac
caagccgaaaggatgctggaagagcacaaagttaagaaaagtgaagtaaatcaattactt
actcatactgccgatgaaggcgaaaaaatagttgtccgagttagacagcagggtgctgat
gctgctactcaggctgaaattaaacgtattatggaaatttctgaaaattataaacgtcgc
tggaaccagacatgggaagaacaagatcgacgtctagcacaaaaccttcaaatttgtcag
ttcaattttgatctcagacagattcattccgaaatagatgaactccaccaccacctgcag
gccaggcgtggtaattatggcaataatttgcctgctgcaaggatgacatcacaagctttt
aaacagtttgaaatgactgttgagcttattgaaaagaagataaacagtttcattagtact
gctgaactaatggtacaagacaaacattatgattctgtacatatacatcaagaaattgat
gtcttaaagaagaaatggagtacattccacaccagtgtgacagattaccgctctcttttg
gatatttctgtgatgtacttccaaatgatagaagagactgagcaatgggtcagagaaggt
aatcaaatgctgatcaacattgggcgtcaagctactgaatgtcgtcagccatcagatgca
accacattgattataaagttacaaaagtttgttgaaaatgaaaaaccaataatagaacag
aaagtcaacaaaatctctgaactgtcacatgaactttacggtgatcaaggcgccaacaag
gttcgccatgttgtagtttcttatcaagatcttcttcagtctttccaacaagctgataat
gaattgtcagctttgaaagtgaaactggagggtaatgaggcttcaggtgttgaggaacat
atcccaatgcagatagatatccctgtcaatgaacaggcagttgtgttgaagcctcctcgc
attactcaacatcttaaaaatgcagaagtcctggaaggaactaagtttatttttgaatgt
cacatcgaaagtgatgaaattccagaggttaaatggttcaaagacaaccttcctttaaca
agtcctgattatgaaacacgttttgagaacggtgtagctactttaactattgaagaaaca
ttttctgaagatactgctcgttacacttgtcgtgtgacaaaccaggctggaacagctgaa
tcttcagctcatctaaatgttaaagaaacacatcaacagataattccaccagatatcata
aagaatttaaaatcagctgacattttggaaggaagtccatttacctttgagtgtcaaatt
actggtatgccaacacctagtatctcatggtacaaagatgaccaaaatattgacaactct
cctgatttcgtcattacaaaaataaatggaacctgttgtttgaaaatccgtaaagttaca
atgcaagaaggtgcacgctacacttgccgtgccaataatgccggtggtgaagcttcttca
tctgctcgcttgactgtgaaacctttggagaaaccaattatacacgaacctttgatgaat
cgaacaattactgaaggcaaaagtattagctttcgtattgttttctctggagttcctaat
cctgaagttctatggtttagaggaacagaacaaatgatcaattccaatgtttttaagatt
tcaactgaacataatatttccatattggatataatggaagcttatccagaagattctggt
ccctattctgtattggttcaaaaccccgcgggtgaagctcgctcatcatgccagttgacc
attgaacaaatatattccagtactggagaggagatgtctcagtcatcaactgatgttgaa
ccagtaaaaccatttttctctcagcttcttcaagcaactgctgaagttattgaaggaagc
cgagttcggcttgactgcattattgtgggaaatcccgaacctgaggtgatctggtatcat
aatgataagccagtgaaagaatcaaaggacatacagttattatttgaaggtgatagatgt
actcttgtcattagagaggtgtatttagaagatgcaggtctatatagatgtgtagcacgt
aatcctcatggtgttgctgaaagtcattgcaaactaattgttgaagctctgagtgaaatg
agtgacggctctggtacagatttggttgcaccaactttcccagaactgctcactgatgta
gccagcaaaccaggtgaaaatgttactttgagatgtactgttcatggtatgccaattccc
gaagttcagtggtttagagaaggtatattgattgaaccatcttctaaatataagaccgtc
tgtaatggcgatgtgcattcacttataattcctgaaacttttggagaagatagtggcact
ttcatggtaaaagctgtcaatcctgccggagaagccaaatgttatggaaaattgttagtt
aaatctgagaaacaaccaggaatggaacaattaactatggttcgtcgtacagttgagaaa
gtaactactgttacaagaactgaagaaattaaacagtcacctccagaatttactaaattg
tttcaagatgttacagtgaaacaaggcgagccagttatgcttgagtgcataattactgga
acacctaagccaaaagttgtttggcaatacaatggagacctcattgatataagacaacat
caaccatgtatggaaggagacaaatatcgtttgatcattccaaaagctagtgaacgtgat
gctggaagattcaccattacagctgagaatccttcaggaagagcaacatgttcagcacga
gtcattgttgagaaagttctaccagtcccaatggaagctagttaccaatctcaatttact
cgaacagtcactcaatcagaaacaagattaagccgtataattgctgatatgcaagaaaag
agcatgtcaggaatggaacatcattctactaccattactacacaagtaccaccaaaattc
gaagtaatgggtgcacctgttgctacacatgatagatttgctacctccatcacaactgat
ctcgccccacaatatcaacaagtagatctcaggattgaagttcccataccaccaaaattc
cttcaagccctcaaaaatattactgctcttgaaggcaccaaagtcacttttgatggtgtt
gttactggtaaacctgaacccagtatcaaatggtataagaaagataaggaaattactgac
ggagcagactttgaaatttcatacaaagatggccgtgtttctcttaccataccagaagtt
cttgaagagcaatcaggccaagttacttgtacagcatctaattatgttggatgtgcatca
agtactgctgaactgattgttagagcttccatgataccaccatctttcactgaaagactt
caaagacgccaagttaaagaaggagaatctgtaaaattaacagttcgtgttgctggcaca
cctgccccacaagtcatgtggtatagggaaggatcccgcattgttagttcccctgatttt
gaaatcatccaagagggagatattcatactctctacattccagaggttttctatgaagat
tcaggaaaatttactgtcaaggctaaaaatcctgctggagaagcagaatgtatggctgaa
ttgagagtgcaagcaccaccaccaccagtagtggagagttttgcgcatatcaaacctgtt
gtgcctacacatcaggcagatgtttacatgcgcccagttgaaccaccacagccgattcaa
gaacctgtacatccttcaccaattagacatgtacaagctcctgttcctaaaccagttcct
aagcctgcacaagaacctgctctcaaacctacacataaagagaaacctgaaaaaccttct
ccaataaaaagtgtacaacctccagtacctgttcctccagctgatattaaaatggatgtg
gatgaaccggaacaaactttgccaccctttgaaaaacgtcttaaactttttgaccaacca
gctgaagtacaagaacctgtgattccagctgcagttaaaccacagatgaaacctgctcct
catctcaagccgtctttccctaagccacttcagaatgttactgtcaatgaaggtgaaaaa
gtaatctttgaagtcattatcactggaaaccctgaacctgttgttaaatggtttaaaaat
gaaaagatcatacacaattctccagattttgaaatcacatatatcaatggtgtcagcaga
cttgtaattgctgaggtatttgctgaagattctggccaatacaaatgtgttgctacaaat
gtacaaggtactaacacatccactgcttacttagatgtaaaagaacctatatcatcatca
gaggaatctcctccagtttctgcaaatgtacctcaagaattaccagtattaacacctgta
ccagttgtgcaagttcctactgcatcaccaattctgggagttagaaaagttcctttcaaa
ataccatcacctgctccagttcccaagccaccaccaccaccacctgttgctgaggaacca
tttttagaaccaaagaaaaaaccaacagtgaagtttggtgcacctgttacacagcctcca
agattcattgaaccattacagaatgccatgctaattgaaggtatcaatgtgatgcttgaa
tgtactgtgattggaaagcctttcccacagattatgtggacacattttggacttccagtt
attgaagacgaaaaccaccatgtttatactgatgtagttacaggccgttgtaccttctta
atttctaaaagtacattaagagataaaggtgattacacttgcactgctcagaatatagct
ggtcaagacgctacaagtgcagttcttgttgaagcaccaagtgttcccaagctgattgat
ggaattgaccatgcacctaaaaagcctgtaccaaaacctgaacatgtacctgtaaagaaa
gtggatgacaaattagcaaaacctgcacctcaggatttcaagagttctgcttttgaggaa
cgtctgaagcaggaaattcaattccgtgagggaaagattcatttcactagtgacgttgga
agtacaagtgaatatgattcagaacatcccgaggataaagtatctgttggtaaagaacat
cccagaataacacagacactgaaaaacttccgtttaattgaaggttcagatgtaacattt
gtctgcaaagtaactggaaaaccaagaccaaagattgcttggtacaaaaatggtgtaaga
atgaagcgttcaggacgttgtgacatgaaatatactcatgatggttactgtactctaaaa
attcgacttgccataccagaagatgctggccactatacagtgcttgcagtgaactcaaca
ggaagggacacatgttctgcagaactctatgtagattctgtaggaactattgatgccact
tcatttgttgaaccagaaacactagaacgaatgctcaaaagagaccaagataaaattaat
caaagtgctggtggcggtggagtttttgaaaaagcttcaaagcccgccttccaagttata
ccagaaaaccaagaagcccgtgatggtcaaactgtaagatttgattgccttgtgactgga
cgaccgtatcctgaaattagttggtacaaaaatgaaatagaaatgcgtagtgatgactac
cacaaggtggttgtgaatgaaaatggaatacattccttgataattctttctgccacaaga
caagatcatggacaatatagatgtgttgctcgaaacaaagctggtgaagcagtgttcttc
gtaacattaaatgttatggaacgacaagaaatacatccaccacattttgttgaacgtctt
caaaattataatgctaaagaaaatcaaactgtcactttgacttgtactgcagttggttgc
ccattgccaatgatgagttggcaaaaagatgccaggatgctttcctctaaagattatgat
atatctactgaaaatggccgttctacattgaccattaaaaatgccacaccagctgactca
gcttggtttcaatgttctgctgtcaacgttgctggatctgcccttacacgagctagactc
aatgttattggaaaaggtccacaacaaccaattacaactccagaagcaccaatgtttgga
gttagaaggagtacttctcctgaggagattccagctcctatagatgaaatggttgtttgt
gcaccagcaccaacaactgaaacaccagttgacggtcagcctactgaagacgaaccagca
ttcaaacctccatctgtagcagaggcgaagttgatttttgatcaatctggcaaaccactg
cctccaccagcaacacttccaagagtacaacctaaaccagaattcataccaaaacctgta
ccaaaacctgcaccagttcaggagaaattaatttcacccgacaaaaaagtgaaacctgtt
aaagctcctgttcctgttccagttccagttccagctgaatcaacattgccacgtggagat
tcaccaccaagctatgaaattcaggaagaaggaccagtacaacagattagctatgcttct
gagataggaagcgctgtgctcaaaattgttgatcaagtggatataatgagggatgaagat
aagccagtgagaaaacctactccagctcctgaattgactaaaccaagcaaagtggaacca
tatactgcaccaaaacctgcaccagttcctgagccaaaaccagctcctattattccagca
cctccagttattaagcatgttgaaagtccaaaattatccaagaagcctgtacagccacca
gcagctcctaagccaccaccaattactccagttgcaaaagtaccagttgcaaaaccacct
caaaggaaaagaagccccaaaccggtaacagacaatgaaaaagttgctaatgcaaatgtg
aaaactccatggaatgctgcaaatagtgaagtttataaagcactaatggaagaaaagact
gcaagagtatcacatgatgatcttttcaagatggaagctgagatacaattacagaaaatg
aaacaagaatctcacatacgccgacgcagtgtacatccaactgaaattatatacaataaa
agcaagaaaaagaggcctgttttcagaactcaactgaaagatgttgaagttgctgaatat
gaccgcacacatttggaatgtctgctgactcctattaatgatcccacaatgaaagtggaa
tggttaaggaatggacaacctttaccttatggtcatcgttacagaccagtatatgaattt
ggctatgttgtgcttgatcttcttttcaccatcccagaggattcaggcatttattctata
aaagctacaaatgcatatggtgaagcaacaataaatgcagaagttgtttgtctaaacaaa
acatctattattattggaactcaacttcctgaaggccaagaagcaattgcccgtttacgt
cagttggagagttacaaaaatatttctcttatggttggaaactatgctgaagatgcagat
attccatcagaacctgcaccacccattattgaaattaaaccagaaccggttgaaattgat
gaaggagaaactgctaaatttattgttaatgttagtggttatccccgaccaagagttact
tggtggataaatggaagccttgttgcaggaggaagcagatttaaagtaagatatgatggt
gtgatacattatcttgaaattcctcgtgtgagggaatatgatgctggccaaataagagtt
ttagccaaaaatcaacaaggtgaagctgaatgtattactacacttaaagtaattccaaag
gaggattggcgttcacatttgcgacatgctcctaaaagcgatctccagattgaactggaa
cgccgaaagagagtggaacttcgcagtgctgaacttaaaatggctcagatgaagagttca
ttggcatctttcgagttgggaatgctcaagcatgagaccactttccgaaaagacacaact
gatgctaacttgcagaagcttcttgctcaagatgcattgagacagcaacttatagatgaa
caatatgagaggatacaaaagacatccactcaaacaataacatttaaacaaccagtcaaa
caagagcctcctgtttttggtattccactttgcccagtcaaagttctggagggtacttct
gtaacactcaaagtgcatttcactagtaatccacctcctattattacctggtacagagat
agcattgaaattcacaattcatgggatttccagattcgagttactgagacttgcagtact
ttacatatttctgaagtattcccagaagactcaggaatgtacacagttaaagcctataat
aaatatggcatgacacaatgcaaagcaaagatgactgttatggaagaagaagaagctgca
aaagaaacttctcctgaatttcgtaacttacttcgtgataccaaagttgttgttggagaa
cctgcaacctttgattgtgaagttattgggaaacctaagcccaaagttcactggcaaaag
gatggcaaaaatatgcctgaaagtccacggtggaaattcattcatgaagaaaaccactac
actctccttatttttgaagttcagcctgaagatgctggaacttatgcttgtgttagcatt
aacacaaatggaaagtcaacatgtactgctaaactgattgttgatgaaccagatgttacc
aaagaatcacatgcacatctgaagttggccaaacaagtaaaagctactccaccaactatt
atgaaaaggccagaaaataaaactgttccagagagtgaaagtgttagtttctcatgcaaa
attacctctaatccacctccggtcgtaacatggtactgtaataatcaccttgtgaaacct
tcaaaatatttcaacatgacttctactcctgatggtgtccatactctaactctgttggaa
gcatttcccgaagacagaggtcaatatagatgtgtggcacgaaatgttactggagaaatt
tcctgtgtttgttatctcaatgttatcggtcttgaaagtgaaacagaaccagagactcct
gaagttccagtttcaccacccagttttattaaaccaatttctaacattgttattgaagaa
ggttatccaacatactttgaagcagtatttacaggagaacctgatccagaaattacttgg
cttcgcaatggtaaaaagattaagaacaccagagactttaagattgagagagttggtcag
acaacaatactgtctatcagggaagcatttcctgaagatagtggtcttattacttgtcgt
gcaaggaacagtgctggtgttgctgaatgttctgctgaattctacgttcaagaggagcaa
gaactgccagaagacaaagtttctcgtgcaggaatgaaattagttcaaccaaagatacct
gtatttaagagatctctttctcaaacctacaaagtgaaacgaggacaaattgcaagactt
gaagctcaggttgaggcttatccaccaccattggtgaaatggtatgtcaatggtgttgaa
atcctaccatcagatcattaccagatgttccaagaaggagatactgttgtcttgatcatc
attcatgttgatgaaaaggatattggagagtatgtcctgagagttggaaatgagcttggt
gaaatcacatgcaggacaaccattacttttgatgaaaagcaaaaggttgtgcaaatacca
gatgaacctgattccgttaccattaaaatgattgagaaagaagaaaagactattacaact
gaaatcagggaaataaggcctatttttgttgagcctattcaacctgaggtgttcgtccga
gaaagaggaattgcaagacttgaatgttcagtagatgctcatccccctcctttgattact
tggtatatcaatggaatggaaatcaagccttctccacattatgaaatcttttacgaatct
ggtaaaagtttgctgatcattattgatgttggaccagaagatactggtgaatatacatgc
agagcagtttcagaattaggtgaagctgtgtgcagtactaccttatatgtccaagaacct
gctgcagaaatgtcaccacctcctgaaacagaagaggaacctcctgtagaggactttatg
ccaccaaactttataaaagacttagaaacaatggatgtggtcgatggccaagaaataaaa
atgatatgcaaagttgttggaaaaccagttcctcatgtttcttggttccataatgggact
aatattgataacaatgatgaatatgtcatttcatacaacccagagacaggagatatttgt
ctccatatcgtggaagctcttccagaagatcgaggagattatgtttgcatggctatcaat
caatatggacaagcagctacatctgctcgactgacagttcatgaaccaaagaaagaagaa
gtcattattcctgttcagaagaaagatcagaaagccaaaccagctgctattcctcctgaa
tttgtggaacctttgcaaccacaaactgttcaagatggttctcaagttgtattgacttgc
agaatgaatgcttatcctgaacccaaaattacttggtataaagactcaattgagattgta
ccaaataatgatttccagataacatttgaaatagaaactggtagatgtaagttgattatt
actgaagtctatccagaagatgcaggagaatatacttgccatgccagaaacatttatgga
gaatctgttacttccacaactgttattgttgaaacttcaataacaacaactgagaccaca
acaaaatctatgacaaccattcctcttgatgaaagcatcaaattagtcgatgaacattac
attacttctattcagatgtcacctcattatattgaaccaactgaggtttatcatggaaaa
cctgtcagactaatatgccagttgactggagaacccaatgtctcctggtatatcaatgag
gttgaggttcgaccgacacctaacaggaaaatgtttattgaacataatacatcaatatta
ttgattgtaaatgcaacatatgaagatactggagaatacatttgccgtatggaaaataaa
gaaggtgtatcaataagtagagcatctatcaatgtgatgaaacaaattgaagcaccactt
actgagccagcagctcctgaattcacagaattacttcagccatatactgttcatgatggc
gatagagcagaatttagagtgcgtttcactggccaacctttgccaaaaataacatggttt
tatgatggtaaagttataacatccaccaatgatatacaaattactgtagattatgaacga
aaagaaagtattctcattattgtggaagtattccctgaagatgaaggagaatacacttgt
tctgcatcaaatgagtatggtgagacaataacaacatgcaaactgacagtcacatcttca
tctggtagtgaagctattgaatctgatgaaacacataaacaaaccattatagttgatcag
ccgcaaatagtagaattacctgatgaaactgtctatcaagaacatgtagagtttcaatgt
gatgatcgaagagaatctgaaactgacctattttatgatgcacctgaggaagttactcag
acagaggaaattagaacaatatctacaacaacttcttattttgaacagactgaagaagtt
ccagctgatgtaaaagctactgaaaaacatactactactttaacagtagatcaaaaagaa
aaatctacacctgtagagttacgattccaagttagtgaacccgtgactgaaactagaact
gaaattcatgaatcaactcacataacttccgaagaaattcctgctaaggacgatgtagtt
attgaacgtgaaaacatccataaagaaacaattgaaatacttcataaagaacaacctgaa
agtgaacctgcagttctttcacagaaagaaatacagccagttcttcaacctcaaagaatt
gaagttgaagttaaggagcatgttatgaaaatgaagtcacctgaggttcaagtagttctg
ctccctgatacagttgatgcaccagtttcagaagcagttgaaatacctgcacaaactgat
gtaccacttgaagttgtagaaatacctgcacaaactgatgtaccagttgtaaaagcagtt
gaaatacttgcacaagctgatgtgctagttggagaagcagttgaaatacctacacaaact
gatgtaccagctgtagaagcagttgaaatacctgcacaaactgatgtaccacttgaagtt
gtagaaatacctgcacaaactgatgtaccagttgtaaaagcagttgaaatacttgcacaa
gctgatgtgctagttggagaagcagtcgaaatacctacacaaactgatgtaccagctgta
gaagcagttgaaatacctacacaaactgatgtaccagttgaagttgttgaaatgcctgca
caaactgatgtaccagttgtagaaattgtcgaaatacctgctcaaactgatgcaccagtt
gtagaagtagtcgaaatacatgcacaaattgataaaccagtagttgtagaagtagctgaa
atacctgcgcaaacagtagatatggtttcagtttctcgtgaaacaattgttttgaaaaaa
gaggaacagccagtagttgaagaggtcataaaggaagaaataacagagaaagagaaacca
gttgaaaaagaagttgttgagaaagctggtaaagcaccaatatttacttggcatttgaca
tcattgaaagttatggatggtgaagaagtaaaattttactgtgaaatcgatggtcagcca
atgccagaaatagtgtggtaccacgaggaagtacctatttccgaaaaccaagatttcaaa
tctatatacaataaggaaactggaagttgttctttactgatttctgaagtattcccacaa
gatgctggtgaatataaatgtgaagcaaccaatgctctaggtactgctgttagtagagcg
tatttggaaatagaatcatatgaatatattcctgatagtgaagaagcttcatcacaggaa
gctccatctccaagaccagtgttggaagaaactgaattgaagcaattgtcttatgaagaa
gttaagaaattgattcaagaagagacttcagttgctgaagtttctactgaattgccagga
actagtgtagttgaaaagcaatatcacactgctaaaaccgtggagatggttctgactggt
gaagcagaatcaactactgatattagtcagaagcaaattgctgagttccaggtcacatca
caaataattaaagatagtattcaaaaagctgacatagaatcaccaatcagtgctagagca
gcttcccagatacaaatcccagatcaaagtcagttgagtgaattgcagtcagtttcagaa
gaacaagtcaaatctgaatcagtcatttctgtttcacagcaacatgaagcaggatttgcc
actgaaacgaaagttgttgaaaaggttgaagacttggagcaacctcaaatatttgacttt
gaacagaaaatagagacacctgtaacaagggatattgttcaagttgaagagaaagttgaa
caactgcttgcagaagaaagcaaagtatctcttgaaacggtgagtgttgatcaaccacaa
gtatttcatattgttagcagtaccgaagaacaaacaaccattgaaagtgtacctggagtt
accaaagaagctgaaaaacgacaaccaacagttgcaaaatctgtcactatgaaagaagtc
actgaagaatctatagttactgagttacatgaacttccagaagcaacaactgacatagaa
gaaatcactctggatatccataaagttgaagagaaacatgccaaggaaagtaaagtactt
gttgaaatggaaagtctagagcaaccagaagttgtaagtattgatggtaaagttcaagaa
caaacacatattcagaaaatagtatctgttaccaaagaggctgaaaaacaacaaccaaca
gtcgctaagtctgctgttatcaaggaggtcactgaaggatcagttgtgacagagttgcaa
gaatttcctgaagaaacaactgatgtacaagaaatcactttggatatccataaggttgaa
gagaaatatgccaaagaaactaaagtatctgtggaaatggaaagttttgaacaacctgaa
gtttttgctattgatggcaaagttgaagaacaaacaaatgttgcaagtattcctggtgtt
acttttgaagttgagaaacaacaaccaacagttgctaagtctgttgttatgaaagaacta
acagaagaatctgtagtgacacaattacatgaacttcccgaagaaacaactgaaatggaa
gaaataactttggatgttcgtacagttgaagagaaacatgccaaagaaagtatagtagct
gttggactggaaagagttgagcagccagaggtatttgatattgatagtaaagttcaagaa
caaacaacttcttctgaagtacaagtaattgctgaaacatctgcaattgattcgcctgtt
atttctaaatcaacactcctttcagaagatgttcctgaaaatgttgtaacacatgttaag
gaactagatcaggaaacaaccttaggacaggaaattgtttctattgttcatgaaacagat
caacttttaccgaaagaaactaaagttgatattgaaactgttgctattgagcatccagat
gtatttagtatcagtgaaagtgttgaagaaaagacaactgttcaagaaattgataaggtt
attactgaaactattgagaaacacttaccaactgctgctaaaactgttgctatgcaagaa
cttattgacgaggcaactgcaagtgatgttcaagaagaagtagaagaaaaaactgttcct
gatgaagtttcatccatacgtgaacaatacatgcaaaatctccctgttgaaagtaaagca
gctgtagaaatagaattgatagaacacccagagatattgaatcttccagaaaaaacagaa
tataagcctagtactcaagaaattaagcaagttacaaccaaacctgagaaaacatatcct
acttcagcaaaagcttttgctttagaggaaatgacagaacatgcaactacaatggatctt
gaagaagctcctgtagagactttgaagagtgaaggtgtaaccagcttccaaatacagtat
gaacagagagtagaaagggaaactcaagctgcacctgatgaatctataattgaagtgcca
gaagttgtaaatgttgctgaaaaagtggagcaaaaacttagtagtgctgaaatgaaagta
gtaaaagaaatggctgaaaaatcaatgccaatcatgagcaaatctgttacactagaagaa
tttactgaatcatcttcaataatatcattggatgaagaaacttcatctcaaccagttgtt
gaggaagtgacagctcctgaagagactactggtcatatttctcctaaaacagcaaagagt
gttgttcttgaagagatatttgaaattcctgaagtcaagcaactggaggaaaataaaact
gaaagtatggaaaaaccttctagtgtacaagatttagatgtgaaatataaaccatctgat
gccttccttactcaaacagtgccacttgaagaagttgttgaggaacttaaaacatatgag
ttaacacgtgaagttgaaaagcaaacagatgaaagagaggtatcacctctaagtaatgtc
tgtgctcccttagctccttctgaaagtaaggcagatgtcactgaagaattacttgaacca
tctgtaattgataatgtgaaacaacaagatacaatgaacttgagtgttattggtgttgag
ttggatactcaatccgtgaaaacacaaccaatcactgaaaccactactcgctctgttgta
gaagcttttgaacaaccaaatttgactgaagtcacacttccatcgactgaaacagctata
gctaaagatatgccaattgaaactttgcaagctcaatatgaagaggtacctgagattttg
gaaacatttgttgaaaaccttgtaactgaagtaatttcagaaactgtggaagaaagtaag
atgccttcatttgaagtcagcttaaaagatattaccgttgttgaaaatcatgttctccat
atggaagtatttgtcagtggaacacctatgccagaagtgaaatggtatttgaatcaagtc
gaacttgctccttcaccaggcgttcatatcagacaagaaggttatcgttctgaatacatc
gttgaagaagtgtttcctgaagatcaaggtttatattctgttattgcaactaatgaattt
ggcacagtgacttcatcagcttacattactgtattgtctgcttctggtccttcttctgat
gttgaaattgaagaagagcaaaaggaagtcactaaaacatttgtggaagagatttcaata
gatgcaaaaccagtaatggaacaagttaatattgaaataattgataaaacatatggaatt
cagaaaggtgaaagctttgaaagtgaagaaacatttgaagaatgcattgaaggtcaggca
gtttctgatgatagtggtgaagatcattttgaagaatgctatcaagatgattatgtggaa
tcagaaattgtacctgatgtaagaaaagaagagcacattgaaagagaaacaatagttcaa
aaagtaggcatccagattcaaccagcagaagtttcaaatttcaaaacagaagttgtattg
tcaccagaagttaaaaaggaagaaatcaaatttactgtatctcctgaacaagtattcaaa
gaagaagttaaaatagctactgaaccaagcaattttgtggacacaataactataaatgtt
gatgctcagaaagaaattgtcaaagaaattgtaaaaactgagatgaccaaagatgtagct
gtggaatccagttttaagaatgttcttatgttagagcctactaacattttagtggatgtg
gatgagcccgatacaataccatcagaaacaatgcaaattcactttgttcaggaatcaaaa
gaaactgttagtgaagaaaaatcattaaggttttctacagattttgaaaatatacagcca
gaaacatctgagaatttagccataaacaaagcagaaatcacagccaaatctgaagtttgt
atcaatgaaattttagatcatttgacaatggaaaaaagtgaaaatgtcattgcagaagca
tctccagtagaaatgatcgttgaaaatatagaatctgatataagagttattcaatcagta
gaaaaaccagtgcagaatgttgaactaataccagaggtaattgctgctgaaaatgctgat
gcagtttatcaggaacctacaccagttgaacctacacctgaagtgattgaatctaaaggt
gtagaacaacatgtgattaccgaaaaacatattcaaaatgttgcagtcttacctgaagat
ttgccagtggaaaatgttgatattttccctcgggaaccatcacctgttgagactacacct
gaagtgattgaatctaagggtgtagaacaacatgtgattaccgaaaaacatattcaaaat
gttgcagtcttacctgaagatttgccagtggaaaatgtctatattttccctcgggaacca
tcacctgttgagactacacctgaagtgattgaatctaagggtgtagagcagcatgtggtt
actgaaaaacatgttcaaaatgttgcagtgttacctgaagttctacctgctgaaaatgtt
gatattttccctcgggaaccatcacctgttgaaactacacctgaagttattgaatctaag
ggtgtagaacaacatatggtgacagaaaaacatgttcaaaatgttgcagtgttgcctgaa
gttcttccagctgaaaatgtctatattttccctcgggaaccatcacctgttgaaactaca
cctgaagtcattgaatctaaaggtgtagagaaacatatggtgacagaaaaacatgttcaa
aatgttgcagttttacctgaagatttaccgactgaaaatgttgatattttccctcgggaa
ccatcacctgttgaaactacatctgaagtcattgaatctaaaggtgtagaacaacatatg
gtcacagaaaaacatgtccaaaatgtcacagtcttacctgaagatttggcacctgaaaat
gttgaagctttccctcgggaaccatctccagttgaagtacagtctgaacttattgaatca
ggatctaaagatacccatgaattatcagagaagcttgaaattaatgttgaaggttcttca
gaagatactattcttgacctattagttgttgtgcccagagaagaatctccagttggtaca
acatttgattatgacaccactgaaacaacaaaagaacaagttttaattgtgcaaaaagaa
attaaggttgatgaattgccagatactacagttattgaatcctctcatgatgtcatcaaa
gaagtatgtgctgtagaacctgtagctgaaattgttccatcatctgcttctcagaagcct
ttcattactcaaggatccatctgtgctgaggaaattccacaagagactgagattgataaa
ttgataattattcctagagaaatccctacttcagcagaaattcagattgctgaaattact
gatatggtgataccaactgtatcagaagaaattaatgtatatgaggacaaacctgtagaa
gttgaggaagaatcatttgaagatgcagctgaaccatctgatgaagaaaaggaaagcctt
gaagatttcaaagaatgcatagacattactgtggaaccagaaatatcagctgtgaagaaa
gagattattgagactactagagacaaaacttcaaaagttatggttcaaatcaaaccaaaa
gaagagaaggcggagaaaacaatttctgtaacaaatcttgttcagcatgaagttacttta
gctgagcatgtacctgttgttatgcaagttgaggagaaatataaagtagacaaaactatt
cctgttacaagtcctaaaaagagtggtataaaaataaatgtttctgaaaatattcagaag
gacatatcaatctcagaagcatctttgttcaaagaatctgtaaatgtggtaaccaaacca
cagttagaagagattcacatggaaattgttcctgaaaagaaggttgatgttaaagagact
gtagaaattgtccggaaagttacagaagaaagaattcccgagagaaaggaagaaccagtt
gataaaattgctgtatttaaagaagctgtggaaatctcacccaaaccaggttttcaggaa
gttcatatgacaattgttcctgagaagaaggttgaagtcaaggaaactgtaaaagttgtc
cagaaagttaaagaggaaattacgcccaagaaaaaggaagaaccagtggatgaaactgca
gtatttaaagagggtcttgtaattgcccccaaaccaacatttgaggaagttcacatgact
attgttccagagaagaaggttgatgtcaatgagacaatacatattgttcagaaagttact
gaacaaattacacctgagagaagggaagaaccagtggatgaaactgcaatatttaaagaa
ggtctagaaattactcccaaaccaaagtttgaggaagttcacatgactatcgtttctaag
gaaaaagacattcctgttgaaagaaaaccagagatgcatattgaagttagaacagttcct
gaacaactaaatgtaacacaaaaagaaacatattccatagaaacaattgcttcacatcct
aaagaacctgaatttgaaaaagaaatcaggataattaaaaaggattccactagtgaaatt
gtaaaacagaaatctgagtatattcaaaagaccattgatatatcagagattcataaaaaa
tctactaaactggaagttattaaagaattccatgatattagtgtccgtgaaaaagataca
tttattcttgagataatattcgaagcacatcctgctccatcaattacatggtattttgaa
gatgtagttatcgaatctactgaagaatttttaattgtgattgaagaaaacagaactatg
attgttgttaaacaagctatattagaagatgaaggagaatataaagtgaggattgaaaat
gatgctggttcatatgtatctactgcctatgttacagtattaccattatcaattagtgat
actgaatttgaaacccagcgagcagttgtaagtgaacaggagaagatggaaattaagcaa
gagttccacaagtttgagattaacattgatgttagtagccgtggagcacctccaaaacca
gaaccactccccgtggcagaagtgaagccattgcttgaaagaactgaaacaactacaata
atcacggaacagaaagtagaaacagtaactgagtcaacaaccaagaaagaaacaactgaa
gcagctccatcagaaggtggggaacccacaaatgttggggatgccagcatgcagaccttc
ctcttggccatgattatggttatgatgttcatacgattcatggcgtggctcttaagtttt
ggttgctgtttttggtgctgttttttctgttgtctatggcagtcataa

DBGET integrated database retrieval system