KEGG   Octopus bimaculoides: 106879508Help
Entry
106879508         CDS       T04127                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
obi  Octopus bimaculoides
Pathway
obi00010  Glycolysis / Gluconeogenesis
obi00562  Inositol phosphate metabolism
obi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106879508
   00562 Inositol phosphate metabolism
    106879508
Enzymes [BR:obi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106879508
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106879508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106879508
NCBI-ProteinID: XP_014784601
UniProt: A0A0L8G432
Position
Un
AA seq 528 aa AA seqDB search
MQCDNMSNSLALFISILCFSVALGETLKEALDLPCSYDSYQKPIFSTKTAYDWLKPEASD
YFGTTHGLQSTVQYGQRNCSAVYINSVLRHGSRYPGSDDIATLFNIERLLNKLNFSDESN
RFARDLRSWQSPFSEEDSGLLLELGAREHFDNGIDFARTFGDLLVQNGALLPMQFISSYK
QRCRESLKAFKRGMKSYLQKKSDESDNGYNYDEQVFENMTQYSINNHLMRFFDKCTKYRR
LMKNQTFMSEYYEFYNSNHMTKVVDSVHKRFGLNDTFFETEDVRVMHVACAIEQCFTNVS
NWCQLFDEDDFKVLEYLGDLKQYWKCAYGNQISYKQSCPLAKSIIEDLQNSVNAHVVGER
YTVAKFMFGHAETMAPLYSALGLFNDSDFLQSENYKQVVDRKFRTSFILPFGANIVVVAY
HCSTQQTSNAAGNEQMTEAAGNRPTSEAVETQRTTEATNIEHDDDGQSEDKRLHNGDYVV
QIYVNKHPVAVPECGVICPLEKFMSRYGSFINCDYEEICSLDSSKVEL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgtgacaacatgtcaaacagcctggccctgtttatttccattctctgcttctct
gtagcccttggtgaaaccctcaaagaagccctcgacttaccttgctcatatgactcttac
caaaaaccaatattctccacgaagactgcctatgattggttgaaaccagaagcatctgac
tattttggtaccacacatggcttgcagagcactgtgcagtatgggcagaggaactgcagc
gctgtgtacatcaattctgtactccgccacgggtcccggtaccctgggagcgacgacatt
gccacattgttcaacatcgagcgtcttcttaacaagctcaatttctctgatgaatccaac
cgtttcgcgcgggaccttcgcagctggcagagcccgttctccgaagaagacagcgggttg
cttctggaactcggggcccgggagcatttcgacaacggcatagattttgcgcggaccttc
ggtgacctcctcgtgcagaacggtgccttattaccgatgcagttcataagctcgtacaag
cagcggtgccgagaaagcctgaaggctttcaaacgtgggatgaagagttacctgcagaag
aaaagtgacgagagcgacaatggatacaactatgatgagcaggtgtttgagaatatgact
caatacagcatcaacaatcacctgatgcgtttctttgacaaatgcaccaaatacagaaga
ctgatgaagaatcagacattcatgagtgaatactacgagttttacaacagcaatcacatg
accaaggtagttgatagcgtacacaagagattcggactcaacgacactttcttcgagaca
gaagatgtacgtgtcatgcatgttgcatgtgccattgaacagtgctttaccaatgtttca
aactggtgccaactttttgatgaggacgacttcaaggttcttgaatatctcggagatctg
aagcaatactggaagtgtgcctatggcaaccagatcagttataaacagagctgccctctt
gccaaaagcatcattgaggatctccagaattccgtcaatgcccacgttgtaggggaaagg
tacacagtggccaaatttatgtttggacatgctgagacaatggctccactctattctgcc
ctggggctcttcaatgactccgatttcctccagtcagagaactacaagcaggttgttgac
cgcaagttccgtaccagcttcatcttgccattcggtgcaaacatagtcgtcgttgcatac
cactgcagcacgcagcagacatccaatgcagcaggaaacgagcagatgactgaggcagcg
ggcaatcgaccgacatcagaagcagtggagactcaacggacaactgaagcaacgaacatt
gagcatgatgatgatgggcagtcggaagacaaaaggctccacaatggggactatgtggtg
cagatctacgtcaataaacacccagtggctgtacctgaatgcggagtgatctgccccttg
gagaagttcatgtcaagatacgggagcttcataaactgtgactacgaggagatttgttca
ctggattcttcgaaagttgagctttaa

DBGET integrated database retrieval system