KEGG   Octopus bimaculoides: 106879957Help
Entry
106879957         CDS       T04127                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial-like
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
obi  Octopus bimaculoides
Pathway
obi00250  Alanine, aspartate and glutamate metabolism
obi00650  Butanoate metabolism
obi01100  Metabolic pathways
Module
obi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106879957
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106879957
Enzymes [BR:obi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     106879957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh PIF1 Phage_ABA_S
Motif
Other DBs
NCBI-GeneID: 106879957
NCBI-ProteinID: XP_014785203
Position
Un
AA seq 568 aa AA seqDB search
MCERAILAPINAAVQALNTCLLRQLPTQERCYILVDSVTDPTQVTFFPTEFLNSQEPLGL
PLYKHNLKLGCPIILLRNLEPPWLCNGTCLAVKQMLDNILKATIITGKGTVTNPANGDVI
GEVPDFGPEDTNKAIDAAYKAFYTWKKTTARERSKILKKWFQLMEDNKSALAELLTLEQG
KTLSDATTEVTYGASFFEWFAEEAKRVYGDIAPPTATDRRILLLKEPIGVAGLITPWNFP
IAMITRKLGALLAVGCTTVIKPAEDTPLSALALCQLAEEAGIPAGVVNVVTSSRDKTPAV
GKLLCESPKIATISFTGSTGVGKVLLSNSASTVKRLSLELGGNAAFIVFNSADIDKAVSG
AMACKFRCSGQTCVCANRFLVQSGIHDEFVRCFAKAIETNLKVGDGLKPGVTMGPLINSA
AVDKVDSLVKDALSKGARKVFGGEKLPIGKNFFEPTLLSEVTTDMRCANEEIFGPLAPVI
KFETEDEAVTLANATSYGLAGYFYSTDISQIWRVAEKLETGIVGVNESLLSAAECPFGGV
KESGIGREGGKFGVDEFLEIKYVCMGGL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaaagagccatcttagctccaataaatgccgcagtccaagccctaaacacatgt
ctgcttcgtcaacttcctacccaagagcgatgctatattttggttgattcagttactgat
ccaacacaagtaacgtttttcccaacagaatttttaaactcacaagaaccattgggattg
ccactgtataaacataaccttaaacttggttgtcctattatactcttgaggaatttggag
cctccttggctttgcaatggcacatgtttggctgttaagcaaatgttggataacattctc
aaagccacaatcatcacaggaaaaggcactgtgaccaatcctgcaaatggagatgttatt
ggagaagttcctgattttggacctgaagacaccaacaaagctattgatgctgcttataaa
gcattctacacatggaagaaaacaacagcacgtgagaggagtaaaattttgaaaaaatgg
ttccaattgatggaagataacaaatctgctcttgctgaactactgacattagaacaggga
aagactttgtcagatgctactactgaagtgacttatggagcaagtttctttgagtggttt
gctgaagaagcaaagcgtgtgtatggagatattgcaccacccacagctactgatcgacga
atccttttactgaaagagccaattggtgtggcaggactcattacaccttggaattttccc
attgcaatgattacccggaagctcggtgcactgctggctgttggttgcaccacagttata
aaacctgctgaagatacacccctgtctgctcttgctctttgtcagcttgcagaagaagca
ggtattcctgctggagttgttaatgttgtaacatcttccagagataaaactcccgctgta
ggaaagcttctctgtgaaagtcctaaaatagcaaccatttccttcacaggatcaacaggt
gtgggaaaggtcttgttgtcaaattcagcatcaacagtgaaaaggttatctcttgaactt
ggtggaaatgccgcatttattgtatttaatagcgctgatattgataaagctgtcagtgga
gccatggcatgtaaattccgttgttctggtcagacatgtgtgtgtgcaaatcgttttctt
gtccaaagtggaattcatgatgaatttgtcaggtgttttgctaaagccattgaaactaat
ttgaaggtgggtgatggcttgaagcctggagtgactatgggtcctcttataaattcagct
gctgttgacaaggttgactctcttgtcaaagatgccttgtcaaaaggtgccagaaaggtt
tttggaggtgaaaaactcccaattgggaaaaatttttttgaacccaccctattatctgaa
gtaacaactgatatgcgttgcgccaatgaagaaatttttggaccattggcacctgtaatc
aaatttgaaacagaagatgaagcagtcactcttgctaatgcaacatcatatggactcgct
gggtacttctattcaacagacatttctcaaatttggcgtgttgctgaaaagctagagact
gggattgttggtgtcaatgaaagtttgttatctgctgctgaatgtccatttggaggagtt
aaggaatcaggtattggacgagaaggggggaaatttggtgttgatgagtttttagaaata
aaatatgtgtgtatgggagggctttaa

DBGET integrated database retrieval system