KEGG   Octopus bimaculoides: 106880654
Entry
106880654         CDS       T04127                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
obi  Octopus bimaculoides
Brite
KEGG Orthology (KO) [BR:obi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:obi03036]
    106880654
Chromosome and associated proteins [BR:obi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    106880654
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3 Phage_Mu_F
Other DBs
NCBI-GeneID: 106880654
NCBI-ProteinID: XP_014786184
UniProt: A0A0L8FWR9
Position
Un
AA seq 418 aa
MLLDDQFIAAAQGDVEWLKHCLDKSIIQYDCDGFTPVHIAAFHGQLKCLEYLIEQYGCNV
DVLSITDWTPLLAAVNDSNAKKSMDCFKYLLERGADISISNKDGTTALHRAAQKNHVEIL
KYLLGLGAKLHCKDKDGYTPADLAKILANKECSRILEAAKWHENKKYLAKQMNQLSIIKY
QIIHGQKRYTHIYNEKDPTLGLKADVLKMNETERQKSENETQAKPSKKTSKKPVKYSKST
VKKKRNAPASYKWNYEKFTDKGAFQKYVPNLKDEYPRDFYTQMPKVPGANKYYDGKHKDI
SEIPENLLEYLDMEFDIPNLPNEIIAKALAKDSSLYDRPIVFNCKSVLDVQTKLQPKDNK
NLKHEVGLHLSNDCSSYSFINALQPETKMHLEESLGDKIIKTPLKKRSKTSTKPKKTF
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgttacttgatgaccagttcatcgcagcagcccaaggagatgttgaatggttaaaacat
tgccttgataaaagtattattcaatatgactgcgatggtttcactccagtacacatagca
gctttccatggacagcttaaatgtttagaatacctaattgagcaatatggttgcaatgtt
gatgttctatcaattactgactggacacctcttcttgctgcagtcaacgattcaaatgca
aagaagtctatggactgtttcaaatacttactggaaagaggagcagacatttcaatttca
aataaagacggcactacagcacttcacagagctgcgcaaaaaaatcatgtggaaattttg
aaatatcttttaggattaggtgcaaaactccattgcaaggacaaagatggttatactcct
gcagatctggccaaaatattagccaacaaggaatgttcaaggattctagaagctgcaaag
tggcatgaaaataagaaatatcttgccaaacaaatgaaccaactcagtatcataaaatac
cagattattcatggtcaaaaaagatacactcatatatacaatgaaaaagatcctacattg
ggtttaaaagcagatgtcttgaaaatgaatgaaacagaaagacaaaaatcagaaaatgaa
actcaggctaaacccagtaaaaaaacaagtaagaaaccagtgaaatatagcaaatcaact
gtgaaaaaaaagcgaaatgctccagcttcatataaatggaattatgagaaatttacagac
aaaggagcatttcaaaaatacgttcctaatctaaaagatgaatacccaagagatttctat
acacaaatgccaaaagttcctggagccaataaatattatgatggcaaacataaagatata
tctgaaatacctgagaacttacttgaatatcttgatatggaatttgatatacctaactta
cctaatgaaattattgccaaggctttagcaaaagattcatctttatatgatcgtcctatt
gtcttcaactgtaaaagtgttcttgatgttcaaacaaaattacaaccaaaagacaacaaa
aatttaaaacatgaagtcggtcttcacctttccaatgactgttcatcatattcatttata
aatgccttacaaccagagactaaaatgcatcttgaggaatcacttggtgataaaataatt
aaaactcctttgaagaaaagaagtaaaacttcaacaaagccaaaaaaaactttttaa

DBGET integrated database retrieval system