KEGG   Octopus bimaculoides: 106880796Help
Entry
106880796         CDS       T04127                                 

Definition
(RefSeq) 1-phosphatidylinositol phosphodiesterase-like
  KO
K01771  1-phosphatidylinositol phosphodiesterase [EC:4.6.1.13]
Organism
obi  Octopus bimaculoides
Pathway
obi00562  Inositol phosphate metabolism
obi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106880796
Enzymes [BR:obi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.13  phosphatidylinositol diacylglycerol-lyase
     106880796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X
Motif
Other DBs
NCBI-GeneID: 106880796
NCBI-ProteinID: XP_014786398
UniProt: A0A0L8FWT8
Position
Un
AA seq 275 aa AA seqDB search
MGSGFSEPETNFPNWMSTISDQTSVAHLTVPGTHNTMAFYGGSLIACQYWELYPQLLGGI
RFLDIRCRHFRNGLHIHHGVKYQYADIDTVLRNSLRFLTDYPTETIFMRIKEEYETVENN
RSYEETLKVSIQRYIENGRISSSFSSIPKLGDIRGKIVILQNFPGSAYGLNYNGGLFSIE
DHWYVPTILYSHIEEKWQHVKRQLDTSGADEGSSVIYVTFTSGASSGAYPNAVADRINPQ
LENYLEEKKPKKRFGFISIDFPSSALIGKIIQCNH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggctccggtttcagtgaacccgaaaccaatttccccaactggatgtcgacaatctct
gatcaaacgtctgtagcacacttaaccgtgccaggcacacacaacacaatggctttttac
ggcggaagcctcatcgcgtgtcaatactgggagttatatccacagctattgggaggcata
cgtttcttagacattcgttgtcggcattttcgtaatgggctacatatacaccacggagtc
aaatatcaatatgctgatattgacacggttctgagaaactcgcttcgctttttaacagac
taccccacagagacgatctttatgcgtattaaagaggaatatgaaacggttgaaaataac
cgttcctatgaagaaacgctcaaagtctctatccaacgatatatcgagaatggtcgaatt
tcgagttccttctcttctattcccaaacttggagatatccgtggcaaaattgttatcttg
caaaatttcccgggatccgcgtatggattgaattacaatggtggtttgttctcaattgag
gatcattggtatgtgcctacaattctgtactcacatatagaagagaaatggcagcatgtc
aaacgtcagcttgacacttccggtgcggacgaaggaagttccgttatttatgtaaccttc
accagcggagccagctctggggcttatcccaatgccgtagctgatcgtatcaaccctcaa
ctcgagaactacttagaagaaaagaaacccaagaaacggtttggttttatttctatcgat
tttccgtcgagcgctctgatcggaaaaattatacaatgtaaccattaa

KEGG   Octopus bimaculoides: 106880803Help
Entry
106880803         CDS       T04127                                 

Definition
(RefSeq) 1-phosphatidylinositol phosphodiesterase-like
  KO
K01771  1-phosphatidylinositol phosphodiesterase [EC:4.6.1.13]
Organism
obi  Octopus bimaculoides
Pathway
obi00562  Inositol phosphate metabolism
obi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106880803
Enzymes [BR:obi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.13  phosphatidylinositol diacylglycerol-lyase
     106880803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X FAM35_C
Motif
Other DBs
NCBI-GeneID: 106880803
NCBI-ProteinID: XP_014786409
UniProt: A0A0L8FVW5
Position
Un
AA seq 284 aa AA seqDB search
MLNFPSRYNTDWMSTLSDQTSLAHLTVPGTHNTMAHYGGDMAECQHWLLYSQLQAGIRFL
DIRCRHYRNGLPIHHGIKYQHADFPMVLREIVRFLIDYPTEIIIMRIKKEFQSAENSRPF
EETFQASIQQYIRDGRIWSCFSSIPILGDIRGKIVILQDFRGSAYGLDYNGDMFSIEDHW
KVPTILDLHIGHKWQHVKRKLDASGEDEGSSVIYITYTSGTSFWAWPKAVANRLNPRLQE
YLQGKKPKKRFGIICMDFPTITLIESIIRCNFQSELNSQPTCTK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacttccccagtcgttacaacaccgactggatgtcgacactctcagatcaaaca
tcgctagcacacttaaccgtgccaggcacacacaacacgatggctcattacggcggagac
atggcagagtgtcaacactggttgttatattcacaactacaggcaggcatacgtttctta
gatattcgttgtcgacattatcgtaacgggttgccaatacaccacggaattaaataccaa
catgctgattttcccatggttctgcgagagatcgttcgctttttaatagactacccgaca
gagataatcattatgcgtattaagaaggaatttcagtcggctgaaaatagccgacccttt
gaagaaacgttccaggcgtctatccaacagtacatcagggacggtcgaatttggagttgc
ttctcttctatacccattcttggagacatccgtggcaaaattgttatcttgcaagatttc
cggggatccgcgtacggactggattacaatggtgacatgttctcaattgaggaccactgg
aaggtgcctacaattctggacttacacataggacacaaatggcagcatgtcaaacgtaaa
ctcgacgcttccggtgaggacgagggaagttccgttatctatataacctacaccagtgga
accagcttctgggcttggcctaaggccgtagctaatcgtctcaaccctcgactccaggaa
tacttacaaggaaagaaacccaagaaacggtttggtattatttgtatggattttccaaca
atcactctgatcgaaagtattatacgctgtaactttcaatcggaattgaactcacaaccc
acttgtacgaaatga

DBGET integrated database retrieval system