KEGG   Octopus bimaculoides: 106882342Help
Entry
106882342         CDS       T04127                                 

Definition
(RefSeq) glycogen [starch] synthase-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
obi  Octopus bimaculoides
Pathway
obi00500  Starch and sucrose metabolism
obi01100  Metabolic pathways
Module
obi_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:obi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106882342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:obi01003]
    106882342
Enzymes [BR:obi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106882342
Glycosyltransferases [BR:obi01003]
 Polysaccharide
  Storage polysaccharide
   106882342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 106882342
NCBI-ProteinID: XP_014788471
UniProt: A0A0L8FMP1
Position
Un
AA seq 706 aa AA seqDB search
MNRRRSSLFKSVKDFENDDDSVRDGGSSAAAKNLWFFECAWEVANKVGGIYTVIKSKTPV
TVEELGEQYCLLGPYNEECVRTEVEILEPQYYVYRDVIKSMEDQGIRVYFGRWLIEGYPK
VVLFDISSAAWKLDAFKQELWKLAGIGIPWHDREANDAVIFGALVAWFIAEFCKNLPHVP
CKPMVIAHFHEWLAGVGLIFCRTRLVDCTTIFTTHATLLGRYLCAAKADFYNNLQNFKVD
KEAGDRQIYHRYCMERSAVHCAHVFTTVSEITGLESEHLLKRKPDVITPNGLNVKKFSAI
HEFQNLHARFKDKIHDFIRGHFYGHYDFDLDKTLYMFIAGRYEFSNKGADMFIEALARLN
YYLKQRNSDMTVIAFLIFPTRTNNYNVESLRGQAIAKQLQDTSSYVIHQVGRRLLETCMR
GNIPKGSDILLEEDIVKLKRCIYSAQRRELPPVCTHNVIDDAKDQVLNAIRRCKLFNDRE
DRVKVIFHPEFLNSTNPLFGLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTN
LSGFGCFMQEHIVDPKSYGIYITDRRFRNPEESVQQLTQTLFDFTCLSRRQRIIQRNRTE
RLSELLDWKNLGVYYVKARRIALHKTHPEIFDEDSLTGKKILFPRPPSEPPSPASSRATT
PVPSDGEENDDGHDEEQEELEARVLGLTVSSDDGQNGLSLSEADIS
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtaggagaagtagtcttttcaagtctgtgaaagattttgagaacgatgacgac
tcagttcgagatggtgggtcttccgctgcagctaaaaatttatggttcttcgaatgtgct
tgggaagtagcaaataaagttggtggaatttatacagtaatcaagtcaaaaactcctgta
acagttgaagaacttggagaacaatattgtttgttgggcccttataatgaagaatgtgtc
cgtactgaggttgaaattttggaacctcaatactatgtttacagagatgtcatcaaatca
atggaagatcaaggaatccgggtatattttggaagatggctaatagaaggttatccaaaa
gtagtcttatttgatattagctctgctgcctggaaactggatgctttcaaacaagaactt
tggaagttagctggcattggaatcccttggcatgatcgtgaagctaacgatgctgttata
tttggtgcccttgttgcatggtttattgctgaattttgcaaaaacttaccccatgtacca
tgcaaaccaatggttattgctcactttcatgagtggttagctggtgttggtctcatattt
tgccgcacacgtttagttgattgtacaactattttcacaacacatgcaactttgttggga
cgctacctttgtgctgctaaagctgatttttataacaatttacaaaatttcaaagtcgac
aaagaagctggtgatcgtcaaatttatcatcgctattgtatggaaagatctgctgtacat
tgcgcacatgtgtttaccactgtctcggagattactggtttagagagtgagcacttactg
aaaagaaaaccagatgttataacaccaaatggattaaatgtcaaaaaattcagtgccatc
catgaattccagaaccttcatgcccgatttaaagataaaatccatgattttatccgtgga
cacttttatgggcattatgactttgatcttgacaaaactttgtacatgtttattgctggt
cgttatgaattctcgaataaaggtgcggacatgtttattgaggctttggcacgcctaaac
tattacctcaagcaacggaatagtgacatgactgtcatagctttcttgatttttccaact
cgtacaaataattacaatgtggaatcgctacgaggacaagcaatagcgaaacagttacaa
gatacatcttcgtacgtcattcaccaggttgggcgcaggctgctggagacatgcatgcgt
ggaaatattcctaaaggaagtgatattttacttgaagaagatattgtcaaattaaaaagg
tgtatctacagtgcacagcgacgagaattaccgccagtatgcactcataatgtaattgat
gatgctaaagaccaagtactcaatgccattcgtcgctgcaaattattcaacgatcgtgaa
gacagggtgaaggtaatatttcatcctgaatttttgaattctacaaatccgctttttggt
ttggactatgaagactttgtccgaggctgtcatcttggtgtctttccatcttattatgaa
ccctggggttacacacctgctgaatgtactgtcatgggtatccctagtgtaacaacaaat
ctttctggatttggttgcttcatgcaagaacatattgttgatcctaaatcctatggcata
tatatcacagatcggcgtttcagaaatccagaagaatcggtgcaacaattgacacaaact
ttattcgactttacttgtttatcgcgtcgtcaaagaattattcagagaaaccgtactgaa
cgccttagtgaattgctagactggaagaaccttggagtttattatgtgaaagctcgtcga
attgcacttcataaaacccatccagaaatatttgatgaagacagtttaaccggtaagaag
atcttatttccacgtcctccatctgagcccccatcaccagcctcttctcgagctacaaca
ccagtgccaagtgatggggaagaaaatgatgatgggcatgatgaagagcaggaagaatta
gaggccagagtgcttggtttaacagttagctcagatgatgggcaaaatgggctgagtcta
tccgaagcagatatttcttaa

DBGET integrated database retrieval system