KEGG   Oscillospiraceae bacterium J115: EIO64_01625Help
Entry
EIO64_01625       CDS       T06030                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
obj  Oscillospiraceae bacterium J115
Pathway
obj00430  Taurine and hypotaurine metabolism
obj00620  Pyruvate metabolism
obj00640  Propanoate metabolism
obj00680  Methane metabolism
obj01100  Metabolic pathways
obj01120  Microbial metabolism in diverse environments
obj01200  Carbon metabolism
Module
obj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:obj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EIO64_01625
   00640 Propanoate metabolism
    EIO64_01625
  09102 Energy metabolism
   00680 Methane metabolism
    EIO64_01625
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EIO64_01625
Enzymes [BR:obj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     EIO64_01625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QCI58083
UniProt: A0A4D7AK51
Position
330948..332156
Genome map
AA seq 402 aa AA seqDB search
MNILVINAGSSSLKYQLLNPETGALLAKGLCERIGIDGKFTYKPQVEGKQVLDAVDVAMP
THSEAIQAVLNALVDKDNGVIGSMQEIDAVGHRVVHGGEAFAGSVLITDEVMKALEECIP
LAPLHNPANITGINACTAVMGKDVPQVAVFDTAFHQTMPAKAYMYALPYEYYEKDKVRRY
GFHGTSHKYVSGRAAAMLGKKPEELKLISCHLGNGSSIAAVDGGKSVDTSMGFTPLAGLP
MGTRSGDLDAGILQYLMNKYGMNIDEMLNILNKKSGVEGLSGVSSDFRDLEKAAEEGNAR
AQLAEEKFAYEVKKYVGAYAAAMGGVDAIIFTAGVGENDKGIRAMVCDGLEYMGVKLDPA
ANDVRGKETVISAADSKVKVLLIPTNEELMIATDTAAIVKGN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctggttatcaacgctggcagctcttccttgaagtatcagctgctgaatccc
gagaccggcgccctgctggccaagggcctgtgcgaacggatcggcatcgacggcaagttc
acctacaagccccaggtggagggcaagcaggtgctggacgccgtcgatgtggccatgccc
acccactccgaggccatccaggccgtgctgaacgctctggtggacaaggacaacggcgtc
atcggctccatgcaggagatcgatgcggtgggccaccgggtggtccatggcggcgaggcc
tttgccggctctgtgctcatcaccgatgaggtcatgaaggccctggaggagtgcatcccc
ctggcccccctccacaaccccgccaacatcaccggcatcaacgcctgcaccgccgtcatg
ggcaaggacgtgccccaggtggccgtgttcgacaccgccttccaccagacgatgcccgcc
aaggcctatatgtacgccctgccctatgaatactatgagaaggacaaggttcgccgctac
ggcttccacggcacctcccacaagtatgtctccggccgggctgccgccatgctgggcaag
aagcccgaggagctgaagctgatctcctgccacctgggcaacggctcctccatcgccgct
gtggacggcggcaagagcgtggacacctccatgggcttcactcccctggccggcctgccc
atgggcacccgctccggcgacctggacgccggcatcctgcagtacctgatgaacaagtac
ggcatgaacatcgacgagatgctgaacatcctcaacaagaagtccggcgtagagggtctg
tccggcgtcagctccgacttccgtgacctggagaaggcagctgaagagggcaacgcacgg
gcccagctggcggaggagaagttcgcctacgaggtgaagaagtacgtgggcgcttacgcc
gccgccatgggcggggtggacgccattatcttcaccgccggcgtgggcgagaacgacaag
ggcatccgcgccatggtgtgcgacggcctggagtatatgggcgtgaagctggatcccgcc
gccaacgacgtccgcggcaaggagaccgtcatctccgccgccgactccaaggtgaaggtc
ctgctgatccccaccaatgaagagctgatgatcgccaccgacacggccgccatcgtcaag
ggcaactaa

DBGET integrated database retrieval system