KEGG   Oscillospiraceae bacterium J115: EIO64_04565Help
Entry
EIO64_04565       CDS       T06030                                 

Definition
(GenBank) hypothetical protein
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
obj  Oscillospiraceae bacterium J115
Pathway
obj00300  Lysine biosynthesis
obj00680  Methane metabolism
obj01100  Metabolic pathways
obj01120  Microbial metabolism in diverse environments
obj01130  Biosynthesis of antibiotics
obj01210  2-Oxocarboxylic acid metabolism
obj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:obj00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    EIO64_04565
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    EIO64_04565
Enzymes [BR:obj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     EIO64_04565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: QCI58584
UniProt: A0A4D7AGE2
Position
866779..867879
Genome map
AA seq 366 aa AA seqDB search
MISKLERLLSGGTVTWDRLLVTDGLSPEAVEQITAVSPAAPDRVWVVIDHDTPAGSVAVA
EKQKALLDWARQTGAVFRSGRGIGYALLLESGLREGEIVLSGGAHAAAVGAAGAVGLSLP
PAELAGALESGQISLSPAPPLRLAVTGPLSPYLSVRDLAWTLIRSGQCSGKAVVIRAPQL
TAAQAMDLCGLLGAAGAVTALCVREDFPADETVDLTALQPMATPPGDAARVVPAGETDGL
RVNQVFIGGCGGGSLEALRETADLWRGRTVCPYVRVMVAPATSSVYVQALEEGLLDVFLD
AGALVMNQGCSACWAQSQGRCDQAEVFVSTGSINCAGWAGRAHSGICLTTVRRAAQAALS
GSLYGS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaaactggaacgccttttgtccggcgggaccgtgacgtgggaccgtctcctg
gtgacggacggcctgtccccggaggcagtggagcagatcaccgctgtctcccccgccgcg
ccggaccgggtctgggtggtcattgatcacgacactcccgccggctccgtggcggtggcg
gaaaaacagaaagccctgctggactgggcccggcagaccggcgccgtcttccgctccggc
cggggcatcgggtatgccctgctgctggagtccgggctgcgggagggcgagatcgtcctc
tccggcggagcccatgccgcggcggtgggagccgccggcgcggtgggcctgtccctgcct
ccggcggagctggccggcgcgctggagagcgggcagatctccctgtccccggctccgccg
ctgcggctggcggtgaccggcccgctctctccctatctctccgtccgggatctggcctgg
accctgatccggagcggccagtgcagcggaaaagccgtggtcatccgggcgccgcagctg
accgccgcccaggccatggacctgtgcggcctgctgggcgccgccggagctgtgaccgcg
ctctgtgtgcgggaggacttcccggcagatgagacggtggatctgactgcccttcagccc
atggcaacgccgcccggggacgccgcgcgggtcgttcccgccggagaaaccgacggactg
cgggtgaatcaggtgttcatcggcggctgcggcggcgggagcctggaggccctgcgggag
acagcggacctctggcggggccggaccgtatgcccctatgtgcgggtcatggtggcgccc
gccacttcctctgtctatgtccaggcactagaggaagggcttctggatgtttttctggat
gccggggcgttggtgatgaaccagggctgttccgcctgctgggcccagagccaggggcgg
tgcgatcaggcggaggtgttcgtctccactggctccatcaactgtgccggctgggcgggc
agagcccacagcggcatctgcctgaccacggtccgccgggccgcccaggcggcgctgtcc
ggcagtctctatggttcctga

DBGET integrated database retrieval system