KEGG   Oscillospiraceae bacterium J115: EIO64_14780Help
Entry
EIO64_14780       CDS       T06030                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
obj  Oscillospiraceae bacterium J115
Pathway
obj01100  Metabolic pathways
obj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:obj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EIO64_14780
   00361 Chlorocyclohexane and chlorobenzene degradation
    EIO64_14780
Enzymes [BR:obj01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     EIO64_14780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like NIF HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: QCI60321
UniProt: A0A4D7ARG4
Position
2896449..2897132
Genome map
AA seq 227 aa AA seqDB search
MRFIFLDLDDTILDFHRAERQALSQTLRHFHVDPTDAVLDRYHVLNRRQWELLEEGKLTR
PQVLVRRFQLLFDELGVRAAPQEVCQLYEEQLAQGHFFVPGAQELLEALHTRYELYLATN
GTPEVQNSRIESAGIARYFQNIFISEQMGAYKPSPAFFHACFAAIPDFDAAEAMMVGDSL
TSDIRGARNVGLRSCWYNPQYLPPRPDIPADYTIGALPELPPLLERL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcatttttctggacctggacgacaccattctggacttccaccgggcggagcgg
caggcgctctcccagaccctgcggcactttcatgtagaccccacggacgccgttctggac
cgttatcacgtcctgaaccgccgacagtgggagttgctggaagaggggaagctgacccgg
ccccaggtgttggtccggcggttccagctgctgtttgatgagctgggggtccgtgctgct
ccgcaggaggtctgccagctttatgaggaacaactggcccagggccacttcttcgtgccc
ggcgcccaggaactgctggaggccctgcacacaagatatgagctgtatctggccaccaac
ggcactcccgaggtccagaacagccggatcgagagcgcaggcatcgcccgctatttccaa
aacatcttcatctccgaacagatgggggcctataagcccagcccggccttcttccacgcc
tgctttgcggcgatcccggactttgatgcggcggaggccatgatggtgggggacagcctg
acctccgacatccggggcgcccggaacgtcggcctgcggtcttgctggtacaatccccag
tacctgccgccccggccggacatcccggcggattataccatcggggccctgccggagctt
ccacccctgctggagcggctgtga

DBGET integrated database retrieval system