KEGG   Ooceraea biroi (clonal raider ant): 105274501Help
Entry
105274501         CDS       T05778                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00450  Selenocompound metabolism
obo00970  Aminoacyl-tRNA biosynthesis
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105274501
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105274501
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:obo01007]
    105274501
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:obo03016]
    105274501
Enzymes [BR:obo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105274501
Amino acid related enzymes [BR:obo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105274501
Transfer RNA biogenesis [BR:obo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105274501
 Prokaryotic type
   Other AARSs
    105274501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 105274501
NCBI-ProteinID: XP_011328992
Position
11
AA seq 977 aa AA seqDB search
MIISTNEGNPNALKLIIAAKLAREPFTVQIVNPANAFLGRLPTLKASAELSLFSVSSALR
FLLSIPKESEILNDRWLEWEITQLQPAILSHANMRTPKNLQKSDLWSLLKDLNSELKDKQ
YLIKEHSHLSPADICIWVSLWSTMLLEDVKDNVAKNLPNLYNWLANIEKQSIIQESIKEF
NLERGAKAVASIEAASWFPVNAVSNSRVSESVSSDVNPKEKDAEAISEEELRNVAHSWTT
GQYLEVKESSYPILPKKSERNVLITSALPYVNNVPHLGNIIGCVLSADIFARYCRQRNYN
TLYISGTDEYGTATEAKALQEKTTPQAICDKFFDIHNDVYRWFGIGFDYFGRTSTPEQTE
IVQAFFLKIKSRGYVRSETVEQLHCELCDRFLADRFVEGTCPGCKYEDARGDQCDGCGHL
VNAIELINPRCKMCNSTPVVKHSVQFFLDLPKIEEKLKAYNATVEKGWSSVARVVSKSWL
RDGLKPRCITRDLKWGIPVPVEGFENKVFYVWFDAPFGYISITKRYTKEYQKWWQPPQDV
KVDLCQFMAKDNVPFHTVMFPACLLAVNQNYTLMKYLMATEYLNYEDKKFSKSRGIGVFG
TDARDTGISADVWRFYLAYIRPETQDSNFNWVDLATKNNSELLNNLGNFVNRALVFAEKF
FNSSIPPIELAEEADWSVLALAQRELSSYINAMEHAKLRDGLKHILAISKHGNQYMQFQQ
PWVKIKGTEDDKKRAGTVVAVCCNLACLLSALLAPFMPTTSKQLRSQLGLSNKSYGYIPE
TITNILPTWHKIGKPSPLFTKIEDQSVEVLRKKYAGQQEVNGEVSTTNKAPDDGIASLET
AITKQGTLVRELKAKHDKSVWQPQVAILLDLKKKLADLKGNVNVPEKKLPAKKTPAKNKK
AEPTQVLEQNGDALTDVAALESAIAKQGNLVRELKAKEEASVWKPQVEILLKLKQRLMGL
TGTTTPNATDKKSKKKK
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgattatctccacgaacgagggtaacccgaacgcgttgaagctaattatcgcggctaaa
ttagctcgagagcctttcaccgttcaaattgtgaatcctgccaatgccttcttaggccgt
ttaccgacgttaaaggcgtccgcagagttatccttatttagtgtctcttcagcactgcgc
tttttattatccatacctaaagaatcagagatcctcaatgataggtggttggagtgggaa
atcactcagctgcagccagctatattaagtcatgcaaacatgaggactcctaaaaatcta
caaaaatctgacttatggtctttattaaaagatctcaatagtgagttaaaggataaacag
tacttaatcaaggaacatagtcatttatcaccagcagatatatgtatttgggtaagtctt
tggagtaccatgttgcttgaggatgtcaaagacaatgttgccaagaatttgccaaacctt
tataattggctagctaatattgagaagcaatcgattattcaggaatctattaaagaattt
aatttggagaggggtgcaaaagctgttgcaagtatcgaagctgcttcttggttccctgtc
aatgcagtctcaaattcccgagtcagcgaatcagtatcaagcgacgttaatcctaaggaa
aaggacgcggaggcgattagtgaggaagaacttcgtaatgtggcgcacagttggacgact
ggacaatacctagaagttaaggaaagttcatatcccatactgcctaagaaaagcgaaagg
aatgtattaataacctcggcccttccttatgttaataatgttccgcatttgggaaatatt
atcggttgcgttctttcggccgatattttcgcgagatactgcagacagaggaattacaat
acgctctacataagtggaaccgacgaatacggcaccgcgactgaagctaaagcactacaa
gaaaagacaactcctcaagctatttgtgataaattcttcgacatacacaacgatgtttat
cgttggttcggtattggattcgattacttcggccgcaccagcacacccgagcaaacagag
atcgttcaagcatttttcctgaaaatcaagtcgcgaggttacgtgaggagcgagactgtg
gaacagttgcactgcgagctctgcgaccgatttctggccgacagattcgtggagggcacg
tgtcccggttgcaaatacgaggacgcacgcggtgaccaatgcgacggctgcggtcatctt
gtgaacgccatcgagttaataaatcctcgatgtaaaatgtgcaacagtacacctgtcgtc
aagcattcggtacaattcttcctggatttacccaagatagaagagaagttgaaagcatat
aatgctaccgtggagaaagggtggtctagcgtcgcgagggtggtttcgaagtcgtggttg
cgcgacggtctgaaaccacgttgcataactagagacctgaagtggggaataccagtcccg
gtcgaaggtttcgaaaataaagtgttttacgtttggtttgacgctcctttcggctatatc
agtattacaaagaggtataccaaagaatatcagaaatggtggcaacctcctcaagacgtg
aaagtcgatttgtgccagtttatggcaaaggacaacgttccgttccacacagtaatgttt
cccgcttgtttgctagcggttaatcaaaattacacgttgatgaagtatttaatggcaacc
gaatatttgaattacgaggataaaaaattttccaagtctagaggcattggagtattcggg
accgacgcgagagacaccggtatctcagcagacgtatggcgattttatttagcctacatt
aggccggaaactcaagattccaatttcaattgggtggacttagccaccaagaacaacagc
gaattgttgaataatcttggcaattttgttaatagagctctcgtattcgcggagaagttc
ttcaactcgagcataccgccgatagagctggccgaggaagccgattggagcgtattggcg
ttggcacaacgcgaattgtcctcttacataaatgccatggagcacgctaagttgagggac
ggtctgaaacatatattagcgatttcaaagcatggcaatcagtacatgcaattccagcag
ccgtgggtgaaaatcaagggaaccgaagatgacaagaaaagagccggaactgttgtcgca
gtttgctgtaatctagcttgtcttctgtccgcacttttggctccgtttatgcccactaca
tctaaacaattgagatctcaattaggtttgagtaataaaagttatggctacatccccgag
acgataacaaacatactgccaacttggcataaaatcggcaaacccagtccgctgttcacc
aagatcgaagatcaaagtgtagaagtgttacgaaaaaaatacgctggtcagcaagaggtc
aatggtgaggtatcgacgacaaacaaggctcctgatgacggtatcgcatcactagaaacc
gctattacgaaacaaggcactctggttagagagctgaaagctaagcatgacaagagcgtt
tggcaaccgcaagtagcgattctgttggatctaaaaaagaagctcgctgatctcaagggc
aacgtaaacgtacctgagaagaaattacccgcgaagaaaacacctgccaagaacaaaaag
gccgaaccgacgcaggtgttggaacagaatggagacgccctgacggatgtagcggccttg
gagtctgctattgcgaaacagggtaatctcgtgcgagaattaaaggccaaggaagaagca
agcgtatggaagccgcaagtggagatactgttgaaactgaaacaacgtttgatgggtctc
actggaacaacgacgccaaacgctacggataagaaatctaaaaagaaaaaataa

DBGET integrated database retrieval system