KEGG   Ooceraea biroi (clonal raider ant): 105276505Help
Entry
105276505         CDS       T05778                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    105276505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 105276505
NCBI-ProteinID: XP_011332477
Position
6
AA seq 573 aa AA seqDB search
MITLPIFMLFISYCLININTCDCTYYDYNDFFDEELMLKPLSNNHVYAYFQFTTVWEAVK
CTEILQHSHFFPRGLGEIIGRHNVDELHVSLTEGLWNYQKWGYPFHDAGPGAEIIAWFNK
NITNVDEGWKGLTNALAGLLCASLNFVDASNSMSPEFSFRPTGVTDGPVDSKYLRYSSLP
REIVCTENLTPFKKLLPCDSKRGLATLLNSAHIHNTNYHSLGIHFRSICRDATCTRTSLE
LRQTVSLLYDIVTDVNQDWSIRKFFGMGLSSACPLATLSNIYVDISDNNTNVYELTPTPS
AKLVSLRGGQRNEIAVYDIRAHSSKGIFNVAAVHSTPKSSSINYPSVLYANRYIIGYGQE
RGSLVSKLYNNHWQALDVILLENIPWYLSIYLHSITITRHGQKIRPLAQRYLPGKERESP
YYLELILRLPPHSVTKISIDMDYLFLKWQEYPPDANHGFYMGPAIITALLPIARNYTALP
LDGSTITSSFNASRDDYLVQLRTESLLISLPTPDFSMPYNVICLACTAVALAFGPLHNIS
TKRLVLKRIEKDWKGKLFSFFAGKVFGRKRKQD
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgataaccttacctatatttatgttatttatctcgtattgtttgattaatatcaataca
tgtgattgtacatattacgactacaatgactttttcgacgaggagttaatgctgaaacct
ttatcaaataatcacgtttacgcttattttcaatttactacggtatgggaagcggtgaaa
tgtaccgagatccttcaacattcacatttctttccaaggggattaggagaaatcataggt
cgtcacaatgtcgacgagttacatgttagtttaacagaaggtttgtggaattatcaaaag
tggggatatccattccacgatgctggacctggtgctgagatcatcgcctggtttaataag
aatataacaaatgtggatgaaggatggaaagggctgacgaatgctttagctgggctactt
tgtgcatcgttaaatttcgttgacgcatccaatagcatgtcaccagaatttagttttcgt
cctactggcgtcacggatggaccagtagattcaaagtacttgcgttactcatcgttacca
agggagatagtctgtaccgaaaatctgacaccgttcaagaaattattaccttgcgactca
aagagaggtctggcaacattgttaaattccgcgcatatacataatacaaattatcactcc
cttggcatacattttcgatcaatatgtcgtgacgcaacttgcacaagaacatccctggaa
ttacggcaaactgtctcgttgttgtacgatatcgtgacagacgtgaatcaggattggtcg
atacgaaagttttttggcatggggctgagcagtgcatgcccgcttgcaacgttgagcaac
atatacgttgacatatcggacaacaatacaaacgtgtacgaattaacaccaacaccaagc
gcaaaactcgttagcctgcgtggaggacaacggaatgaaatcgcggtatatgacattagg
gctcactccagcaaaggaatatttaatgttgccgctgtacacagtacaccgaagagtagc
tctataaattatccttcagttctctatgcgaatagatatattatcggctatggtcaagaa
agggggagtttagtgagcaagttgtacaacaatcactggcaggcgttagatgtgatccta
ttggaaaatattccatggtatttgtcaatttacttacattccattacgataactcgacat
gggcaaaaaattcgtccactggcgcaacgttatctacctggaaaagaaagagaaagccca
tattacttagagttaatcttgcgcctaccaccacattcggtaacaaagatttccatcgac
atggattatttgttcctaaaatggcaggaatatccgccggatgctaatcatggtttttat
atgggaccagccattattacggcattgttacccatagctagaaattataccgctttaccg
ctcgatggaagtacaatcacttcgagctttaatgcttcgagggacgattatctggtacaa
ttacggacagagtcattgctgatcagtcttccgactcccgacttcagtatgccatataac
gttatatgtctggcttgtacagcagtcgcgttggcattcggcccgcttcacaacatctcc
acgaagagattggttttaaagcgcatcgaaaaggattggaaaggtaaattattttccttc
tttgcaggaaaggtattcggtaggaagagaaaacaggactaa

DBGET integrated database retrieval system