KEGG   Ooceraea biroi (clonal raider ant): 105277561Help
Entry
105277561         CDS       T05778                                 

Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:obo01002]
    105277561
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:obo03036]
    105277561
Enzymes [BR:obo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     105277561
Peptidases and inhibitors [BR:obo01002]
 Cysteine peptidases
  Family C50: separase family
   105277561
Chromosome and associated proteins [BR:obo03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    105277561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT RIH_assoc
Motif
Other DBs
NCBI-GeneID: 105277561
NCBI-ProteinID: XP_026826947
Position
7
AA seq 624 aa AA seqDB search
MAHAVGQIMQILHECHPENNDLVDNFKRLKITRKSRRNVKKDKLQEIKNKAEKLLTDTPY
NYTGSVEYASLNKMLAICNFEMGDELRAIHHLTESHAVILRQHILHRYQNTQLRETLCTE
PQTYGLKPTHVKFETDLANSGKLLKSKLVELPKEWYIIQVTALYESPSVLRHEKRMSSVM
HAVHITILPTGLSDVEPLCITLPKPETQVSYDVCEEILKLLDNNKFQLKATYVNREQYWA
MRTNQNSKMKIGIDGLENMWLREWRVLFMADAIENLNIVNEVHEMVDKLITDLSLRNIKI
TERCRWLLKKVSVGACFLTREEIARAVKFLLPKHEKLAKNIILSVYGMLPCINELKNAKR
KTLVLIIDEHMDYIAFEAMEIIKYHPVTRFPSLHIAYALFKEHEDIMVEGCRIIKAKEDL
GISVINPSGDLEKMERRLKLFMNFWLPQWKSCYNTKPDEKLFEDALVNHDILMYNGHGSG
IQYLSGEDIEKMRVKSTVLLFGCSSVKLLLIGGRYPPHGVSNQYLIACSPCLLGMLWEVT
DADIDTMTANFMSNWIPSTAERSWTEVDIASWSSGTLKFTKNRVNDKMEMESEMLRAVAN
AKRSCSQYMTAAAIVVRGLPIKIV
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgctgtcggtcaaattatgcaaatcctgcacgaatgtcaccccgaaaataat
gatctcgtagacaatttcaaacgcttgaaaatcacgagaaaatcgagaagaaacgtgaag
aaagataagttgcaggaaatcaagaataaagcagagaaattacttacagatacgccgtac
aattatacagggagtgttgaatatgctagtttgaataaaatgctagctatctgtaatttt
gagatgggagacgagctcagagctattcatcacttgaccgaatctcatgcggtgatactt
cgtcaacacattttacataggtaccaaaacactcaactgcgtgaaacgctatgcactgaa
cctcaaacgtacggattaaaaccgacgcatgtgaaatttgagactgatcttgcgaatagc
ggcaaattgttgaaatcaaaactcgtagagttaccaaaagagtggtacataattcaagtc
actgccttatacgaatctccgagcgttttaaggcatgaaaagcgtatgtcaagtgtcatg
catgctgtacatattacaatacttccaacgggactgtctgatgtagaacctttgtgcata
acgttaccgaaacctgaaacgcaagtttcctatgacgtctgtgaagaaattctgaaatta
ttagataacaataagtttcaactgaaagccacttatgtgaatcgtgaacaatattgggcg
atgcgcacgaatcaaaatagcaaaatgaagataggtatagatggattggagaacatgtgg
ttgagggaatggagggtactttttatggcggatgccattgaaaacttaaatatagtaaat
gaggttcatgaaatggttgataaattaataacggatttaagtctccgtaacatcaaaata
accgaacgatgtaggtggctcttgaaaaaggtgtccgtgggcgcctgtttcctgacgcgc
gaagaaatagcacgcgcagtcaaatttctacttcccaaacatgaaaaactggcaaagaac
ataattttatctgtttatggaatgttaccgtgcataaatgaattgaaaaatgccaaacga
aagacactggtcttaataattgacgagcatatggattacatagcatttgaagctatggaa
attattaagtaccatcctgtcactcgtttcccgtctctgcatatagcatacgcgttgttc
aaagaacacgaggatatcatggtggaaggttgcaggataatcaaggccaaagaagacttg
ggaatttctgtaattaatccttcgggcgatttagagaagatggagagacgcctgaagctc
ttcatgaatttctggctaccgcaatggaagagttgttacaataccaagcctgacgaaaaa
ctgtttgaagatgcgcttgttaatcacgacattttaatgtacaatggtcacggtagtggt
atacaatacttatccggagaagatatcgaaaaaatgagggtgaaatctaccgttttatta
tttgggtgtagcagcgtgaaattacttctaataggcggaaggtaccctcctcatggcgtt
tcgaatcagtatttgatagcatgcagtccttgtcttcttggtatgctgtgggaagtaaca
gatgctgatatcgacacaatgacggcaaacttcatgagtaattggattccctcgacggcc
gagaggtcatggactgaagtagacatagctagttggagttccggtactctgaaattcacg
aagaatcgagtgaacgataaaatggaaatggaatcagaaatgttgagagcagtagcgaac
gccaaaaggagttgctcgcaatatatgacagcagccgcgatagtagtgcgaggtttacca
ataaaaatagtttaa

DBGET integrated database retrieval system