KEGG   Ooceraea biroi (clonal raider ant): 105278830Help
Entry
105278830         CDS       T05778                                 

Definition
(RefSeq) mitogen-activated protein kinase 15 isoform X1
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obo01001]
    105278830
Enzymes [BR:obo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105278830
Protein kinases [BR:obo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105278830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Spt20
Motif
Other DBs
NCBI-GeneID: 105278830
NCBI-ProteinID: XP_011336514
Position
12
AA seq 723 aa AA seqDB search
MSEKKTAERVSEIDAHISKQYDIVRRLGKGAYGIVWKAIDKKRKDTVAVKKIFDAFRNQT
DAQRTFREIMFLLSFANHENIIKLIGLHKADNDRDIYLVFEYMETDLHNVIKRGNILKDI
HKVFIMYQLFKAIKYIHSGNVIHRDLKPSNVLLNAQCHCKIADFGLARSVTQIGEGDGES
GSDPTLTDYVATRWYRAPEILVASKRYTKGIDMWSLGCILGEMLLGKPLFPGSSTINQVE
RIMATLPPPTDEDLISVSAGYGTNLLEKTPSGPRRALTDLLPEVSEKALDLISNLIVFNP
TQRLTAVESLGHPYVADFHRRGNEPERGSSVVPLLSDDVQLTVDEYRNKLYAMMDDKHRK
HKNMSKSRLRRLSEHIRKEVSGSKSNPVIGQGDATAASLQNRRTIRPPPQGDKARTMSTV
ETPGAQENPLVKSRLNVRNAATQYACNVTNGSLAANLPPATAKSCFYLNQQQHQHQQQQQ
QQQQSQSLLSKSQRSIQSDQMAMHTTGGRSNQLAAPVAPRAKLRRVCRQPQVLAQAPKPF
ALASANCRGDDQRPRTIPTKPTVVRVTGSPGGIIKQALMPSNVTKHFVRSTGSSGGGGGH
LSSPESPYFSQQQAIRNYLNQTMPQRHSRPREGAMSCQDSRGSHFIERTTSCNVGVANNR
TRSATRGSQATRGLDIARRRSSATATTTGMTTCDKSRFLSSHSQNHGVIAASVYRELCNG
TIG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaaaaagaccgccgagagggtctccgagattgacgcgcacatcagcaagcag
tatgacatcgtacgacgcctcggcaaaggggcttacggtatcgtgtggaaggcgatagac
aagaagaggaaggacaccgtcgcggtgaagaagatcttcgacgcctttcggaatcagacg
gacgcgcagcgcacgttccgcgagattatgttcctgctgtcgttcgccaatcacgagaac
atcataaagctgattgggctgcacaaggcggacaacgaccgggatatttacctcgttttc
gagtacatggaaaccgacctgcacaacgtcataaagcggggcaacatcctcaaggacatc
cacaaggtcttcatcatgtaccaactttttaaggcgatcaagtacatacactcgggcaac
gttatccatcgagacctgaagccgtccaacgtgctcctgaacgcgcagtgtcactgcaag
atcgcggacttcggtctggcacgctcggtcacgcagatcggcgagggcgacggcgaatcc
ggcagcgatccaactctcacggactacgtcgccactcggtggtaccgcgcgccggagatc
ctcgtggcttcaaagaggtacacaaaggggatagatatgtggtccttaggctgtatcctc
ggcgagatgctgctcggcaagccgctcttccccggctcgtcgacgataaaccaagtcgag
agaataatggcgaccctgcccccgccgacggacgaagatctaatatcggtcagcgccggt
tacggaaccaatttgttggagaagacacccagcggacctagacgagctctcacggatctg
ctgccggaggtgtcggagaaggccctggacctcatcagcaatttgatagtcttcaacccc
acgcaacggctcaccgccgtcgagtcgctcgggcatccttacgtcgccgacttccacaga
cggggaaacgagccggagaggggctcgagcgttgtgccgttgctgagcgatgacgtgcag
ctcaccgtcgacgagtacagaaacaagctgtacgcgatgatggacgacaagcatcgcaag
cacaaaaacatgtccaagtccagactgcgccgtttgtccgagcacatcaggaaggaggtc
agcggcagcaagagtaatccggtgatcggtcagggcgacgcgactgccgcgtcgttgcaa
aacagaaggacaatcaggccgcctcctcagggcgacaaggcgcgcacgatgagcaccgtg
gagacgccgggggcgcaggagaaccccttagtgaaatcccggctgaatgtcaggaacgcg
gcgacgcagtacgcctgcaatgtgacgaacggcagcctggcggcaaacttacctccggca
acggcaaaaagttgcttctaccttaatcagcagcaacatcagcatcaacagcaacagcag
cagcagcagcagtcgcagtcgctgttatcgaaatcccagcgctccatacaatcggatcag
atggcaatgcacaccaccggaggcagatcgaaccaattagcggcaccagtggcaccacgc
gccaagctacggagggtctgcagacagccgcaggtcctcgcgcaggcaccgaaaccattc
gctctggcgtctgctaattgtcgcggtgatgatcagcgacctagaacaatcccgacgaag
ccgaccgtcgtcagggtcaccggcagtccggggggaatcattaagcaggcactgatgccc
agcaacgtcacgaaacacttcgtcaggagcacggggagcagtggtggcggtggcggtcac
ctcagcagtccggaatcgccgtatttcagtcagcaacaagccatccgcaactacctgaac
cagacgatgccgcagcggcactcgcggccgcgcgaaggtgcgatgtcctgtcaggacagt
agaggcagccacttcatcgagcggacgacctcgtgcaacgttggggtggcgaacaatcgc
acgaggagcgcgacgcgcggctctcaagcgacacgcggcctggacatcgcgcggaggagg
tcgtcggcgacggcaacaacgacggggatgacgacgtgcgacaagtcgcggttcctcagc
agccacagtcagaaccacggcgtgattgccgcgtccgtttacagggaactctgtaacggg
actatcggctag

DBGET integrated database retrieval system