KEGG   Ooceraea biroi (clonal raider ant): 105279489Help
Entry
105279489         CDS       T05778                                 

Definition
(RefSeq) protein IWS1 homolog isoform X1
  KO
K17498  transcription factor SPN1
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:obo03021]
    105279489
Transcription machinery [BR:obo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105279489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 105279489
NCBI-ProteinID: XP_011337606
Position
9
AA seq 922 aa AA seqDB search
MGFEDETADSGDEHDKPRSITPDSQRSGSNAARSRSRSPPSISTPYSPARSNQSSPVRNG
SPASIRSNVSSRKSYSRSPSRSPSRSPNRSASPNVRRSTSRSSLSRSHSPEPIEASVRNG
SQSPAHSHHSIKSGFRSRSSSRSESRSSHAASRNNSRSRSRSNSVKPSNSPSKCASPKTN
FRSTSRSPSPRVASKSRSHSRSRSRSRSRSESPKILVHSRSRSATPKSYHSRSRSRSGSA
SPQREKTASRSSSRSPSGSKKDSPLASPNRSPINISQSQSRSKSRSRSISRSRSRSKSCL
ENDSREGSPNLRKNSHSRSRSNSVNRKSKSRSRSRSGSASRKQVESPAREERVSKSRSKS
RSNSRSLSGSRKGSRSRSRSRSHKSGSICKSRSVSRSRDGSVSPARSGKNSRSRSRSSSR
SSKSKSRSRSVSRASRSRSRSGSRKSVSRSRSRSGSRSRSRSRSKSGSRSRSVSRSVSRS
KSRSISRSRSRSGSRSKSRSRSRSGSGVASRHSSRSKSRSRSKSRSRSGSESKRSRSGSR
DSESVVKKRKRLLSDSDEEIDGVKTKKQHELSDSENEDEGKEKKDDAQEKEGEGHEDKQI
DVEAGEQQDNEDSDDGIITGSGMSSKYLDDTLSDFDRMLARKKEEQSRRRKRKDIDIIND
NDDIIAQLLSDMKGAAEEDRKLNQQNKPATNKIAMLSKVLSQLKKHDLQLAFLEHNVLAV
LTDWLAPMPDRSLPSLKIRDNLLKLLWEFPKIDQASLKQSGIGKAVMYLYKHPKETKDNK
ERAGKLINEWARPIFNLSADFKALSKEERMQRDLEQTPQKRRKTEDGGSFQKSQDINKAL
KGDAKPLRPGDPGWVGRARVPRPSNKDYVIRPDWKSDIDISRSTKKQMSRFERHMKNYMD
SKRMKSTRRAVDISIEGRKMSL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgaagatgaaacagccgattcaggagatgaacatgataaacctagaagcatt
acaccagattcacaaagatcaggcagtaatgcagccaggagtagatcaagatcgccccct
tcaatttcaaccccatatagtcctgcaagatccaaccaatcatctccagtgcgaaatgga
tcaccagcttccatccgttccaatgtaagctctagaaaatcctactccagatcgccatcc
agatcaccgtctcgatcgccaaatcgttctgcttccccaaatgttaggagaagtacatca
agatcatcgctttctagatctcactctccagaacctatagaagcaagtgtaaggaacggc
tcacaatcaccagcacattcgcatcattctataaaatcgggctttagatcacgaagttct
tctcgttctgaatccagaagttctcatgcagcatcgagaaataattcacgttcccgatct
agatcgaattcagtaaaaccaagtaactctccatccaaatgcgcctcgcctaagacgaac
ttccgatcaacctctagatccccttcgccccgagtagcttcaaagtctcgttctcattct
cgttcaagatcgcgttctcgatctcgttccgagtctccaaaaatattagttcactcgcgt
tctcgatcggctactcctaaatcttaccattcacgatcccgatcaagatcaggatccgct
agtcctcaaagggaaaaaactgcgtcaagatcaagctcacgatctccatccggatcaaag
aaagattcgccattagcatcaccgaatcgatctcccattaatatcagccagtcacaatca
agatcgaaatcacgatcacgatcaatatcgagatcgagatccagatcaaagtcctgtctc
gagaatgattctagggaaggttctccgaatttaaggaagaactctcattctagatctcgt
tccaattcggtaaacaggaaatctaaatcaaggtctaggtcgagatcaggttccgcatct
agaaaacaagtagaatcacccgcacgagaagaacgagtttcgaaatccagatccaagtct
agatcaaactcgagatccttgtcaggttcgaggaaaggctcacgttcaaggtcgcggtcc
aggtcacacaaatctggatcaatatgcaaatcaagatccgtatcgagatcgcgtgacggt
tccgtgtctcctgcgcgctcgggaaagaattcgcgctcaagatccaggtccagctcgcgt
tccagtaaatcgaaatcgagatcccgctctgtctcaagagcttcacgttcaaggtctcgg
tcggggtcaagaaaatccgtatcaagatcacggtcaaggtcgggatcaagatcacgatct
cgttctagatcaaaatctggctcgagatcacgttctgtctcacgttcagtgtcaagatcg
aaatcgagatcaatatcaaggtcgagatcgaggtcaggctcgcgttctaaatcgcgttca
agatcaagatccggatcaggagttgcgtccaggcattcctcgcgttctaaatcacgatct
agatctaaatcaagatctcgatcgggctcggaatccaaaaggtccagaagtggcagcaga
gattcagaaagcgtagttaaaaagcgcaaaagattattgtcagattctgatgaagagatt
gatggcgttaaaacaaagaaacaacatgaactatcggattccgaaaatgaggatgagggc
aaagagaaaaaggatgatgcgcaagagaaggagggtgaaggccatgaagataaacaaata
gatgtggaagctggtgaacaacaagataatgaagattctgatgatggaattatcaccggt
agtggaatgagcagcaaatatctggatgatacattgtccgatttcgatcgcatgttagca
cgaaaaaaagaggaacaatcacgcaggcgcaaacgaaaggacattgacatcattaatgat
aacgacgatattatagcacaattgttatcggacatgaaaggtgcagctgaggaggacagg
aaattaaatcaacaaaataaaccagcgacaaataaaatcgccatgttgtcaaaagtattg
tcacaattgaagaaacacgatttacaactggcctttttggaacacaacgtgctggctgtt
cttactgattggttagcgccaatgcctgaccgttcactaccatctctcaagattagagac
aatcttttaaaactattatgggagttcccaaaaatcgatcaggcttcactgaaacaatcc
ggtattggaaaggctgtgatgtatctttataaacatccaaaagaaacgaaagacaacaaa
gagcgcgctggaaaattgatcaacgagtgggcacgacctatctttaacttatccgcagat
ttcaaagcgctatcaaaagaggagagaatgcagcgagacctggagcaaacgcctcagaaa
aggaggaagaccgaggatggaggatcctttcaaaaatcgcaagatatcaacaaagccttg
aaaggagatgccaaaccattgagaccgggagatcctggatgggtaggaagagcccgagtt
cctagaccatcgaacaaagattacgttattcgtcctgattggaaatctgacattgacatc
agtaggagtaccaaaaaacagatgagtcgattcgaaagacatatgaaaaattacatggat
agcaagcgaatgaaatccacaaggagagcagtggatatatctatagagggtcgtaaaatg
tctttataa

DBGET integrated database retrieval system