KEGG   Ooceraea biroi (clonal raider ant): 105279692Help
Entry
105279692         CDS       T05778                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00010  Glycolysis / Gluconeogenesis
obo00562  Inositol phosphate metabolism
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105279692
   00562 Inositol phosphate metabolism
    105279692
Enzymes [BR:obo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105279692
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105279692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105279692
NCBI-ProteinID: XP_026826999
Position
7
AA seq 477 aa AA seqDB search
MRALLLPLIASLLACSSIRSVLARDADFCFADEDDPYLYMATKTAYHFVHGGKTRFQNVP
NCRPAQIWMLAAHGTRCPTINEINEIVGLTELKEQILHNHEIRGDGHMCNRDLENLRRWR
PDEYLAPQRAEVLTPQGVEDMRLLARRLQSNFPELLLPSASNITSANYKFRATEARDSMA
SFMEGLFGSRTAILPEESSLNDTLLTAYKTCSVWENDKDVQPFENTEGSKFDAGPELQNL
LRNVSRRLGFLYNISTEKIVAMYDACRYEKAWAVTKLSPWCAVFSKDELRILEYREDLYY
YYKAGYGRDINSRLGCPLLHDMMQHFWNLARDETSNEPAGIFYFSDVISLQNLLTTMGIN
EDPMPLAAFNFKDMARRQWRTSMISPFAGNLVAVFYKCNDITDRNKVMFYLAEKPVRYEG
CQVGLCDWQFLKSKFGELASSCKLDICWKGNTAPSSFPNSIAVLLAYAVLCLGYRQL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgttgttgctgccgttgatcgcatcgctcttggcctgctcgagcattcgcagt
gtgctagcacgcgacgccgatttctgcttcgcggacgaggatgacccatacttgtacatg
gccacaaagaccgcctaccatttcgtacatggaggcaagacccggttccagaatgtgccg
aattgccggccggcgcagatttggatgctcgccgcacacggtacccgttgcccaaccatc
aatgaaatcaacgaaatcgtcggtttaactgaactcaaagagcagatactccacaatcat
gaaatacgtggtgatggtcacatgtgcaaccgagatctagaaaacttgagaagatggcga
ccagacgaatatttagcgccacagcgagcggaagtcctgacgccgcaaggagtggaggat
atgaggctcctggcgagaagattgcaaagcaacttcccggaattgctactgcccagcgcc
agcaacatcacatccgccaattataagttccgtgctactgaagcacgcgacagtatggca
tccttcatggagggactatttgggagcagaacggcgatacttcccgaggaaagttccctg
aatgacacattgctgaccgcatacaaaacgtgctctgtatgggaaaatgataaagatgtg
cagccgtttgaaaatacggaaggcagcaaattcgacgccgggccggaacttcagaatctc
ctgaggaacgtcagtcgacgacttggttttctctacaatatctctactgaaaaaattgtt
gccatgtacgatgcgtgtcgatacgagaaggcctgggccgtcactaaactttcaccttgg
tgcgccgtcttcagcaaggatgaactccgcattctggagtatagggaggacctttattac
tactacaaagccggctatgggcgagatattaatagccgtctaggatgtcctttgttgcat
gacatgatgcaacatttctggaatctagcacgtgacgagacatcaaatgagcctgcgggt
attttttactttagtgacgtcatcagtctgcagaatcttctgactacaatgggcataaac
gaggatccgatgccattagctgctttcaactttaaagacatggccaggcgacaatggcga
acatctatgatatcacccttcgccgggaatctcgtcgcagtgttttacaaatgcaatgac
atcactgatcgcaataaagtgatgttttacttggcggagaaaccagtgcgatacgaaggc
tgccaagtgggtctctgcgactggcagttcctgaagagtaaattcggcgagctggcctca
agttgcaagctggatatctgctggaaaggaaacacggcgccttccagttttccaaattcc
atagcagttttattagcgtatgctgttctttgccttggctaccgacaattgtaa

DBGET integrated database retrieval system