KEGG   Ooceraea biroi (clonal raider ant): 105279919Help
Entry
105279919         CDS       T05778                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00010  Glycolysis / Gluconeogenesis
obo00562  Inositol phosphate metabolism
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105279919
   00562 Inositol phosphate metabolism
    105279919
Enzymes [BR:obo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105279919
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105279919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Latarcin
Motif
Other DBs
NCBI-GeneID: 105279919
NCBI-ProteinID: XP_019887368
Position
7
AA seq 447 aa AA seqDB search
MYGKLGLFILLVFILPEDTKSRMIKTVNRFRCDAGNSYPYTGIKTPYSKVYNGTINHINL
PNCKPLQIWLLCRHGTRFPKTTKILEMLNMTRFRDLIVNNHEIDHRGQLCRRNLRALKRW
RSFPELDATKGKHLSLQGRKDLSSLGNRLRRKFPELFVEDVPEKYKFRSTNTPRTIDSMM
FFVKGSFKDTFSVKLEVGSASNDTLLKIYENCEPWEKERFSKEVTAFINGSEMTKVITDI
SRRLGFVNNISKEDAFLLYDMCRFERAWQPSKESPWCAAFTDEDMHVFEYEEDLYHYYSV
GPGREINSKLGCHPLRDMVDRFTKLENAEDSDEPRGVFYFTHSEMIMLFYSVMEIGKNPV
HLTASNYRDMQHRNWRTSLLVPFATNFATVFYRCDSSDSPFKIAFYLAEKPLTLEGCNNG
VCDWAQLKKKLVPIAANCSTEVCWKTS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaaagctcggtttattcattttgctggtatttattctgccggaagatacaaaa
tcgcgcatgatcaaaactgttaaccgctttagatgcgacgctggtaattcttatccttat
actggcattaaaacgccatatagtaaagtttacaatggtactataaatcacattaattta
ccaaactgtaagccattgcagatatggctgctatgtcgacatggcacgcgatttccaaag
acaactaagatcttggaaatgctaaacatgacgcgcttccgagatctcatcgtgaataat
cacgagattgaccatcgcggacagttgtgtcgtaggaatctaagggcgctgaaaagatgg
aggtcctttcccgagcttgatgcgacgaaagggaaacacttatcactgcagggtagaaaa
gatctgtcatcgctcggcaacagactccgtaggaaattcccagagctcttcgttgaagat
gtgccagagaagtataagtttagatcgacaaacacgccacgtactattgacagcatgatg
ttctttgtaaaaggatctttcaaagatacattctcagttaaattagaagtagggtcagcc
tccaatgacactttgctgaagatatatgaaaattgcgaaccgtgggaaaaagagcgcttt
agcaaagaagtgacagcattcataaacggttcggaaatgacgaaagtcattaccgatatt
agtcgacgactcggctttgtgaacaacattagcaaagaagatgcatttctgctttacgac
atgtgccgcttcgagagagcttggcaaccgagcaaggagtcaccctggtgtgccgcgttc
accgatgaagacatgcacgtcttcgagtacgaggaggacctctaccattactacagcgtc
ggtccgggaagagaaatcaatagcaaacttgggtgtcaccctcttcgcgacatggtcgat
cgttttacgaagctggagaacgcagaggacagcgacgaaccgagaggcgtgttctacttc
actcactcggaaatgattatgctgttctacagcgtgatggaaattggcaagaatcccgtt
catcttaccgcctcaaactatcgggacatgcaacatagaaattggagaacttccttattg
gtgccgttcgccacgaactttgcgactgtattttacaggtgcgattccagcgactctccc
ttcaagattgccttctatctagctgagaagcctttaactctggagggctgcaacaatgga
gtttgcgattgggcgcagctgaagaagaagctggtccccatcgctgccaactgcagcaca
gaagtttgttggaaaacatcgtaa

DBGET integrated database retrieval system