KEGG   Ooceraea biroi (clonal raider ant): 105281650Help
Entry
105281650         CDS       T05778                                 

Definition
(RefSeq) tankyrase isoform X1
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:obo03032]
    105281650
   03036 Chromosome and associated proteins [BR:obo03036]
    105281650
Enzymes [BR:obo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     105281650
DNA replication proteins [BR:obo03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     105281650
Chromosome and associated proteins [BR:obo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     105281650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 105281650
NCBI-ProteinID: XP_011341329
Position
2
AA seq 1214 aa AA seqDB search
MAGRRSTLTNAADSLSGSGGGGGGGGDPLRELFEACKTGDLAKVKALVNPKTVNARDTAG
RKSTPLHFAAGYGRKDVVEFLLSAGASIQARDDGGLHPLHNACSFGHCDVVRLLLEAGAS
PNTRDNWNFTPLHEAAIKGKIDVCITLLQHGADVNIRNTEGKTALEVADASTKPVLTGEY
RKDELLEAARSGNEERLLQLLNPLNVNCHASDGRRSTPLHLAAGYNRSRVVQILLQNGAD
VHAKDKGGLVPLHNACSYGHFEVTEALLKHGAAVNASDLWTFTPLHEAASKSRAEVCSLL
LSEGADPTQLNCHSKSAIDVAPTLELQERLAYEYKGHCLLDACRQADLTKLKKYLSQEVV
NFKHPYTGDTPMHCAVASPYAKRKQVIEALIRKNAAMNEKNKDFLTPLHVATDHSHYDAM
DILLRHNAKVNALDGLGQTVLHRCAREDNMQACRILLSYNVDPSIVSLQGYTAAQIAAEN
VLKILQAIKLVDPPSGTDDAEAQLLEASKSGDLAAVERILQANPHAVNCRDLDGRHSTPL
HFAAGFNRVPVVEYLLAHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNVADL
WKFTPLHEAAAKGKYEIVRLLLRHGADATKKNRDGATPLDLVRDGDQDVADLLRGNSALL
DAAKKGNLARVQRLVTQDNINCRDAQGRNSTPLHLAAGYNNLEVAEFLLERGADVNAQDK
GGLIPLHNASSYGHLDIAALLIKYNTVVNATDKWGFTPLHEAAQKGRTQLCALLLAHGAD
PFLKNQEGQTPVDLASADDVRCLLQDAMASQQIVPSVPSGNMVNNTGGNSINSRPPSIVS
VPVTPPPPLTQETVIMPSGAAMTLCVPLARPTSCLSPMPPSEPCSEKESKDMCKEHNSAI
TTVAGFLQSLGLEHLLELFEREQITLDILAEMGHEDLKQVGVSAYGYRHKLIKGMDKLLN
TAAGSLWQPSINPGTLLVDLLAEDKEFLAVEEEMQSTIRQHRDNGHSGGIFSRYNIVRIQ
KVQNRKLWERYAHRRQEVAEEVGAAAPASPSTGPRGAPTSTVSQANERMLFHGSPFINAI
VQKGFDERHAYIGGMFGAGIYFAEHSSKSNQYVYGICGGTGCPAHKDRSCYICHRHLLLC
RVTLGKSFLQFSAMKMAHAPPGHHSVMGRPSQGGLVFPEYVVYRGEQAYPEYLITYQIAR
PQQESGSSEGVEER
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggcaggacgtagatcgacgttaacgaacgcggcggactcgctgtccggatcgggcggc
ggcggcggcggtggcggtgacccgctacgtgaactcttcgaggcctgcaagaccggcgat
ctcgcgaaggtgaaggcgttggtcaacccgaagacggtcaacgcccgcgacaccgccgga
cgcaagtccacgccgttgcactttgcagctggatatggtagaaaggacgttgtagaattt
cttctatccgctggtgcatcaattcaagcacgtgacgatggtggtttacatccattgcac
aatgcgtgctccttcggacattgcgatgtcgtgagactgctcttggaagcaggagcgagt
ccaaatacaagggataattggaatttcacgcctttgcatgaggcggcgattaagggtaaa
atagacgtatgtattactctgctacagcacggagcagatgtaaacattaggaatactgaa
ggaaagactgcgttagaggtagctgatgcctctactaaaccagtactaacaggagagtat
agaaaagacgagctcttagaagccgctagatctggaaacgaagaacggctgttgcagctg
ttaaatccactaaacgtcaattgtcacgccagtgacggaagaagatctacgccgttgcac
ttagcagctggatataaccgatccagagtggtacagatccttcttcagaacggcgctgat
gtgcatgccaaggataaaggaggtcttgtgccacttcacaacgcctgttcgtacggccat
ttcgaagtaactgaggcacttctgaagcacggtgccgccgtcaatgccagtgatctttgg
acgttcaccccgctgcacgaagccgcgagtaaatccagagcagaggtttgttccttgtta
ttgagcgaaggtgccgatccgacgcaattgaactgccatagtaaaagcgctatcgacgta
gcaccgacactcgaattacaagagagactagcatacgaatacaagggtcactgcctatta
gacgcttgcagacaggcagatcttactaaactgaagaaatatctgtctcaagaagtcgtg
aatttcaagcatccctacacgggagacacaccaatgcattgcgcggtagcgtcgccttac
gcaaagagaaagcaagtgatcgaggccttgatccgaaagaatgccgctatgaacgagaaa
aataaagacttcctcacgccgcttcacgtggcaaccgaccattcgcactatgacgcgatg
gacatactactccggcataatgccaaggtcaacgcgctcgacggtctaggacagaccgtg
ctgcacaggtgtgccagagaggataacatgcaggcttgcagaatactcttgtcgtacaac
gtcgacccttcgatagtgtcccttcaggggtacacggcggcgcaaatagccgccgagaac
gtgctgaaaatactgcaagcgattaaattggtagatccaccgagcgggaccgatgacgcg
gaggcacaactgttggaggcgagcaagtcgggcgatctcgccgcggtggagcggatatta
caggccaatccgcatgctgtgaattgccgcgacttggacggcaggcactcaactccgctg
cactttgcagcgggtttcaaccgagtgcccgttgtagaatacctattagcacacggtgca
gacgtgcatgccaaagataaaggtggattggttcctcttcacaacgcttgttcttatggc
cactacgaagtcacggaattattagtaaagcacggcgcgtcggtgaacgtcgccgattta
tggaaatttactccgcttcacgaggctgccgccaagggcaagtacgagatagtgcgatta
ctcctgagacacggagcggacgccacgaagaagaacagagatggcgcgacgccgttggat
ttagtgagagacggtgaccaggacgtagcggatttactacgtggaaatagcgctcttctc
gacgcggcaaagaaaggcaatttagccagagttcaaagactggttacgcaagataacatt
aactgccgagatgcgcaaggacggaacagcactccgttacacttggccgcggggtataat
aacctggaagtggctgaattcttgcttgaacgtggtgcagacgtgaacgcgcaagataaa
ggcggccttattccgctgcataacgcatcgagttacggtcacctggacatcgcagctttg
ctcatcaaatataataccgtagtgaacgcaacggataaatggggatttactccgcttcac
gaagctgcgcagaaaggtcggacacagttgtgcgcccttctactcgcccacggcgccgat
ccattcttaaagaatcaggaaggacagactccggtggacttggccagcgcggacgatgta
agatgtttattgcaagatgctatggcttctcaacaaatcgttccgtcagtaccctccggc
aacatggtgaataataccggcggcaattccattaacagtagaccgcctagtatcgtatcc
gttccggtgactccgccaccgcctcttactcaagaaacggtcatcatgccgtctggcgcc
gctatgactctgtgcgtaccgctggcccgtccaacatcgtgcctgagcccgatgccgcca
agcgagccgtgctccgaaaaggaatccaaagacatgtgtaaagagcacaatagtgccatc
acgaccgtcgctggcttcctgcagagtctcggcttggagcatctgctggagctgttcgaa
cgtgagcaaatcacgctggacatactggcggaaatgggccacgaggatttgaagcaggtc
ggagtgtcggcttacggttacaggcataaattgatcaagggcatggacaagttgttgaac
acggcagcgggctccctatggcaaccctccataaatcccggcaccctgctggtggaccta
ctggcagaggacaaggaatttctcgcggtcgaggaagaaatgcaaagcaccatcaggcag
cacagggacaacggccactcgggcggtatcttttcacgttacaatatagtcagaatacaa
aaagtccagaatcgcaagttgtgggagcggtatgcgcataggagacaggaggtagccgag
gaagtcggcgctgctgctcccgcctctcccagtaccggaccacgtggtgctcccacgtcg
acggtgtcacaggcgaacgagagaatgctgttccacggcagtccgttcattaacgccatt
gtgcagaagggcttcgacgagcggcatgcgtatatcggtggaatgttcggcgcgggcatt
tacttcgcggaacatagcagcaaaagcaatcagtatgtttacggcatatgcggcggcacg
gggtgtcccgcgcataaggaccgaagctgctacatttgtcacaggcacttgctgctatgt
cgagtcacgctcggcaagtcgtttctacaattctcggcgatgaagatggcgcacgcccca
cctggccaccacagcgtaatgggcaggccgtcgcaaggcggcctggtgttccccgaatac
gtcgtctaccggggcgaacaggcatatccggagtatctgatcacctaccagatcgcgagg
ccccaacaggagagcggcagcagcgagggcgtcgaggaacggtga

DBGET integrated database retrieval system