KEGG   Ooceraea biroi (clonal raider ant): 105282183Help
Entry
105282183         CDS       T05778                                 

Definition
(RefSeq) retinal dehydrogenase 1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00010  Glycolysis / Gluconeogenesis
obo00053  Ascorbate and aldarate metabolism
obo00071  Fatty acid degradation
obo00280  Valine, leucine and isoleucine degradation
obo00310  Lysine degradation
obo00330  Arginine and proline metabolism
obo00340  Histidine metabolism
obo00380  Tryptophan metabolism
obo00410  beta-Alanine metabolism
obo00561  Glycerolipid metabolism
obo00620  Pyruvate metabolism
obo00981  Insect hormone biosynthesis
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105282183
   00053 Ascorbate and aldarate metabolism
    105282183
   00620 Pyruvate metabolism
    105282183
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105282183
   00561 Glycerolipid metabolism
    105282183
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105282183
   00310 Lysine degradation
    105282183
   00330 Arginine and proline metabolism
    105282183
   00340 Histidine metabolism
    105282183
   00380 Tryptophan metabolism
    105282183
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105282183
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105282183
Enzymes [BR:obo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105282183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Flu_B_NS1
Motif
Other DBs
NCBI-GeneID: 105282183
NCBI-ProteinID: XP_011342256
Position
10
AA seq 488 aa AA seqDB search
MAKQVQIKYTQLFIDNEFVDAVSGRKFPTLNPTSGKVIAEISEGDKADVDKAVNAAKRAF
DRNSEWRKMHPYTRGQLMNKFADLVTRDLDYIATLETLDNGKTYASAVEDIQASICTLRY
YAGWCDKIHGDTIPTGHTSVTLTRKEPVGVVGQIIPWNYPFMMLVWKWGPALATGCTLIL
KPAEQTPLSALYAAALAKEAGFPAGVINVIPGYGPTAGAAIAEHPEIQKVAFTGSTEVGR
IIMAACAKSNLKRVSLELGGKSPLVIFDDVDVKEAAEIAHNAIFANHGQNCCAGSRTFVH
SKIYDEFVKRAKQLALNRKVGDPFDKKTDQGPQIDDEMLNKIIDLINSGKQQGAVVQAGG
NREGSVGYFVQPTVFSNVTDDMRIAKEEIFGPVQSILKFDTMDEVIERANRTNYGLASGV
ITRDINKALEFAQAVEAGSVWVNCYDAITPQTPFGGYKESGIGRELGEEGLKGYLEIKTV
SINIAKKN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacaagtacaaattaaatacactcaactgtttatcgacaatgaatttgtcgat
gctgtgagcggccgcaaatttccaacactgaatcccacaagtggtaaagttatcgctgaa
atttccgaaggagacaaggctgatgttgataaagcagtaaacgctgccaaacgggcgttc
gatagaaattcagaatggcgtaaaatgcatccctacacgcgtgggcagctgatgaacaag
ttcgcagatcttgtcacgcgcgatttagattatatcgccactctcgaaacacttgacaat
ggaaaaacttacgcaagtgccgttgaagatatacaagcaagtatctgtactcttcgttac
tatgcaggctggtgtgataagatacatggggataccatcccgacaggtcataccagtgtg
acactgacgcgaaaggagccagttggcgttgtagggcaaatcatcccctggaattatccc
ttcatgatgttagtttggaagtggggtcctgcactggctactggatgtactctgatcttg
aagccggcggagcagacacctttgagtgcgctttacgcagctgctctcgctaaagaggcc
ggattcccagctggtgttataaatgttatcccaggctacgggccaactgctggcgcagct
attgctgagcacccggaaattcaaaaagttgccttcaccggatccactgaggtcggacgt
atcataatggcagcttgcgctaaaagcaatcttaagcgtgtcagtcttgaactaggtggc
aagagcccgctcgttattttcgatgatgtcgatgtgaaggaagctgcggagatcgcgcac
aacgcaatatttgcgaatcatgggcaaaattgttgcgcgggatcgcgcacatttgtgcac
tcgaaaatatacgacgaattcgtaaagcgtgctaaacaattggcgctcaataggaaagtg
ggagatccgttcgacaaaaaaactgaccaagggccacagattgacgacgagatgttgaac
aaaattatcgacttaatcaattctggtaaacagcagggcgctgtcgtgcaggctggtggt
aatcgcgagggcagcgttggctatttcgtgcagcctactgttttctcaaatgtaaccgac
gacatgagaattgctaaggaagaaatttttggcccggtgcagtcgatcttgaaattcgac
acgatggacgaagtaattgaacgtgctaatcgtacaaattatggtcttgcctccggcgtc
attaccagagacattaataaggctttggaatttgctcaagcggtggaagctggcagtgtt
tgggtgaattgttacgatgctattacacctcaaacaccattcggcggatacaaagagtct
ggtataggacgtgaattgggagaagaaggcctaaagggatatctcgagattaagacagtt
tctatcaacatcgccaaaaagaactaa

DBGET integrated database retrieval system