KEGG   Ooceraea biroi (clonal raider ant): 105283036Help
Entry
105283036         CDS       T05778                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00051  Fructose and mannose metabolism
obo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    105283036
Enzymes [BR:obo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     105283036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C
Motif
Other DBs
NCBI-GeneID: 105283036
NCBI-ProteinID: XP_011343784
Position
14
AA seq 147 aa AA seqDB search
MAKKNETPICPHTGGLGLCEMAQHLQMWDFICLSQSTQNRLIEFIDYKHGYFVNPVHIIN
GRYMPPTLPGYSTMFKQKVIERWSYPSGSRWRHLFHLGFPTYFQRKKQQEEKGERKCRRG
FPTRKSENKQTEREKKEETQETEEKIK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagaatgagacaccaatatgcccgcatactggtggattaggcttgtgcgag
atggctcaacacctgcaaatgtgggattttatttgcttaagtcagtccactcagaatcgt
ttaatagaatttatagattataaacacggatattttgtaaatcctgtgcacattataaac
ggtcgttacatgccacctacgttacctggatattcgactatgtttaaacagaaagttatt
gagagatggtcttatccatctggtagtcggtggcgacatttgtttcatctagggttccca
acgtatttccagcgtaaaaagcagcaggaagaaaagggagaacggaaatgtcgtcgcggt
tttcctacacggaaaagtgaaaacaaacaaacagaaagagaaaagaaagaggaaacgcag
gaaactgaagaaaaaataaaatga

DBGET integrated database retrieval system