KEGG   Ooceraea biroi (clonal raider ant): 105284157Help
Entry
105284157         CDS       T05778                                 

Definition
(RefSeq) cathepsin O isoform X2
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:obo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105284157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:obo01002]
    105284157
Enzymes [BR:obo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     105284157
Peptidases [BR:obo01002]
 Cysteine Peptidases
  Family C1: papain family
   105284157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 105284157
NCBI-ProteinID: XP_011345766
Position
12
AA seq 358 aa AA seqDB search
MEWRTVVTIVLVVSLCFFMVPIRVEPDKNVEDAKLFANYIDRYNKSYKDNPEEYKKRFER
FQRSLQHIERMNGFRSSQESAYYGLTEFSDLSGDEFLERTLMPDLSVRSQKHTRASYHRQ
HSTGSVNRVKRMPGILPKFDWRDKGVVGPVRSQESCGACWAFSTVGVAESMYAIKNGTLY
PFSVQEMIDCMPGDYGCQGGDICSLLSWLLASKTEIISENDYPLTWRTDTCRLSKISAKA
QRGITVTDFTCDSFVDAEKELLKTLAIHGPVAVAVNAMSWQNYLGGVIQYHCDGSFESVN
HAVQIVGYDLTASIPHYIVKNSWGPTFGDKGYLYIALGKNLCGKINYKRFSMCDIYSY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcgaacagtggtgacgatagtgctggtcgtaagcctttgttttttcatggta
ccaattagagtggagccggataaaaatgttgaagacgccaaattgttcgcgaattacatt
gaccgatataacaaatcctacaaggacaatcctgaagaatataaaaaacggttcgagcgt
tttcagagatcattgcaacatatcgagaggatgaacggttttcgctcgtcacaagaaagc
gcctattatggactgacagaattctccgatttatccggggatgagttcctggaacgaacc
ctgatgcccgatttatccgtacgaagtcagaagcacacgagagcgtcgtatcatcgtcag
cattctacgggctcggttaatcgtgtaaaaaggatgccagggatactccctaagtttgac
tggcgggacaaaggggtcgtgggaccagttcgaagtcaggagagctgcggcgcgtgttgg
gcgttcagcacagtcggggtggccgaatccatgtacgccatcaaaaacggaactttgtat
ccctttagcgtgcaggaaatgatcgactgcatgccaggcgattacgggtgtcagggcggt
gatatatgtagcttgctctcgtggctgctggcgtcaaagacggaaatcatctccgagaac
gattacccgctcacgtggcgaaccgacacgtgcagattatccaaaatttctgcgaaggca
caaagaggaatcacggtgacggacttcacgtgcgacagctttgtagatgcagaaaaagaa
ctcctaaagacactcgcgattcacggacccgtggcggttgccgtgaatgccatgtcttgg
cagaattacttgggcggcgtaatacaatatcactgcgacggatcgtttgaaagcgtgaac
cacgcggtgcaaatagtgggatacgatctaacggccagcataccgcattacatcgttaaa
aattcgtggggcccgaccttcggcgacaagggctacctttacattgcactcggcaaaaat
ctatgcggtaagattaattacaagcggtttagcatgtgcgatatttatagttattaa

DBGET integrated database retrieval system