KEGG   Ooceraea biroi (clonal raider ant): 105284656Help
Entry
105284656         CDS       T05778                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:obo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    105284656
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:obo03011]
    105284656
Ribosome [BR:obo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    105284656
  Bacteria
    105284656
  Archaea
    105284656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 105284656
NCBI-ProteinID: XP_011346630
Position
9
AA seq 221 aa AA seqDB search
MQSLRQCVTQLAVFGRPMLNRTNALPSTVKPLNLIPACSFHVSLIFNDKRTQGPTRFLNH
NKTIFRPQKPDEERRPAYVCNMRANIKYSPKNMWYIAAFVRGMSVDEAVKQLSFLQKKGA
AIAKEVILEAQRMAVEEHNVEFKSNLWVAESFATKGIVIKGLRRHARGRKGVIHYRYCHY
FVRLEEGPPPKNYYLPYPKSGEELLDDWLKQMHMRKVTNSL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcctgcgtcagtgcgtaacgcaactagcagtgtttggtagacctatgttaaat
aggacgaatgcattaccaagcacagtaaaaccattaaatcttataccagcatgtagtttt
catgtttctttgatattcaatgacaaaaggactcagggtccaacacgctttctaaatcat
aataaaactatttttcgacctcaaaagccggatgaagaaagaagacctgcctatgtatgt
aacatgagggccaacataaagtacagtccaaaaaatatgtggtacatcgcggctttcgtg
cgaggaatgtctgtggatgaagctgtaaaacagttgagttttctgcagaagaaaggtgcc
gcaattgcgaaggaagttatattagaagcccaacgtatggccgtggaggagcataacgtc
gagtttaagagtaatctatgggttgcggagtcatttgctacgaaaggcatagtaataaag
ggattgcggcgccatgctagaggacgcaagggagtaattcattataggtattgccactat
tttgtacgcttggaggaaggaccaccacctaagaattactatctgccatatcctaagagc
ggtgaagagttgttggacgactggttaaaacagatgcacatgcgcaaagtaacgaattcc
ttgtaa

DBGET integrated database retrieval system