KEGG   Ooceraea biroi (clonal raider ant): 105286167Help
Entry
105286167         CDS       T05778                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
obo  Ooceraea biroi (clonal raider ant)
Brite
KEGG Orthology (KO) [BR:obo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:obo04147]
    105286167
Enzymes [BR:obo01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     105286167
Exosome [BR:obo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105286167
  Exosomal proteins of other body fluids (saliva and urine)
   105286167
  Exosomal proteins of colorectal cancer cells
   105286167
  Exosomal proteins of bladder cancer cells
   105286167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 105286167
NCBI-ProteinID: XP_011349205
Position
4
AA seq 1023 aa AA seqDB search
MQPSTSRTMQQPTRASSAHLYRRKLTSEEIEELHHELETIDHMIALETLCEKLNTSTVTG
LTREQARAILERDGPNALSPPKVTPEYIKLFKCMFHGFAALLWVCASLCFVLYVVTYLMR
EPDVGIVWLGIIIVVICITSGVFAHIQETKNIKVMESFRKMVPTFATVMRDGVKLQLGTE
ELALGDLVEIRMGDKIPADIRIIECSGLRVENSSITGESEPVVRTDYPTDPNPLESANVA
FSTSFAVAGDGKGIVIATGDRTMIGRLAGLTSHLAKIETPIAKEIRHFVEIITIVAVLCG
LAFFGLSLLLEPNIVRAFTYLLGIVIANVPEVLLVTVTTVLTLTAQRMASKNCLVKNLEA
VETLGSTSTICSDKTGTLTQNKMSVSNLWFGHTRYNFPPGEIIGVERDLLLEKPAFRIML
RATTLCLRAEFTTESYMQPIEKREIIGDASETGILRFCEHVHPTKKYREAHPKVAEIPFS
SITKYQMSIHQDTTGYTMIMKGAPEVILEKCATILTSDGETKEMTANDHAISRRACTELG
YLGERVLAYCDLHLPGTVYGPEYRFDTDLAASYNFPTERYRFVGLISMQDPPRPGVPEAV
QKCRTAGIKVIMVTGDHPVTAMAIAKKVGIISEGHETRYERAILQGRSYTQLADNTPDSG
AATIITGAELRGMNANELDDVIRHYEEIVFARTSPQQKLLIVESCQRLGEIVAVTGDGVN
DSPALRKADIGIAMGIAGSDVAKNAADMILMDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSSVPEMLPMLSGLILAIPLPLVIELVICIDVGTDLVPAIALAYEKAESDIMRRAPRNPQ
YDKLVNKRLISITYGQIGMTQSFAGFYTYFMVLMMNGFMPTRLLGLRIEWEDPSINDLRD
SWGQTWTYENRMNLLMEAQSGYFLSIVITQMIDLVMCKTRRNSIFQQGMGNWFVNFSFGF
EAILTGLLLYVPGTEYVFHTMPLQAFWYWPCLPLGIFLWVYDELRRLCIRVFPGGIMERE
TYY
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgagcacttcgaggaccatgcagcagccgactcgcgcgtcctccgcgcatctg
tacaggaggaaactgacctcggaggagatagaggagttgcatcacgagctggaaaccatc
gatcatatgatagctctggagactctgtgcgagaagctgaacacaagcacggtgactggc
ttgacgagggagcaagctcgcgcgatcttggaacgggacggcccgaacgccctgtctcca
cccaaggtcactccggaatacatcaagcttttcaagtgcatgtttcacggattcgccgcg
ttgttgtgggtctgtgcgagtctgtgcttcgtcctgtacgttgtcacgtatctgatgcgg
gagcccgacgtcggcatcgtgtggctaggcataatcatcgtcgtgatatgcatcacctcg
ggcgtgttcgcgcatatacaggagacgaaaaacatcaaggtcatggagtcgttcaggaag
atggtgccgacattcgcgacggtgatgcgcgacggcgttaaattgcaactgggcacggag
gagctggcattgggcgacttggtggagatacgtatgggcgacaagataccggcggacatt
aggataatcgagtgcagcgggctccgggtcgagaactcgagcatcactggcgagagcgag
ccggtggtgcgcaccgattatcccaccgacccgaatcccctcgagtccgcgaacgtggcc
ttctccacgtcgttcgccgtggcgggtgacggcaaggggatcgtgatcgccacgggggat
cgtaccatgataggccgtctggccggcctgacgtcgcatctcgccaagatcgagacgccg
atcgccaaggagatcaggcactttgtcgagatcatcacgatcgtggcggttctgtgcggc
ctcgcgttcttcgggctgtcattgttgctcgagcctaacatcgtacgagcgttcacctat
ctgctcgggatagtgatcgccaatgtgcccgaggtgctgctggtgaccgtgacgacggtg
ttaacgctaaccgctcagaggatggcgagcaagaactgcctggtgaagaatctggaggcg
gtggagaccctgggttcgacgtcgaccatctgctccgacaagacgggcactctcacgcag
aacaaaatgtccgtgtcgaatttgtggttcggccacacccgatacaactttccgccgggc
gagataatcggcgtcgagcgggatctgctgctggagaagccggcgttccgcataatgttg
cgcgccacgacgctctgcctgcgcgccgagttcactaccgagtcctacatgcagccgatc
gagaagcgcgagattatcggcgacgcgtccgagacgggtattctcaggttctgcgagcac
gtgcatcctacgaagaagtaccgcgaggcacatccgaaggtcgccgagataccgttcagc
tccatcaccaagtatcagatgtcgatacaccaggacaccactggctacacgatgataatg
aagggcgccccggaagtgatactggaaaagtgcgcgacgattctgacgagtgacggcgag
accaaggagatgaccgccaacgatcacgcgatatcgcgcagagcctgcacggagttgggc
tatctcggcgaacgcgtgctggcgtactgcgatctgcacctgcccggcaccgtgtacggg
cccgagtacagatttgacaccgacctggccgcttcctacaatttccccaccgagagatac
agattcgtcgggctgataagcatgcaggatccgccgcggccgggggtgcccgaggcggtg
cagaaatgccgcaccgccggcatcaaggtgatcatggtgacgggcgatcatccggtgacg
gcgatggcgatcgccaagaaggtaggtatcataagcgagggccacgagacccgctacgag
cgggcgatcctgcagggcaggtcttacacgcaactggctgacaacacgccggacagcggc
gccgccaccatcatcaccggcgccgaattgcggggcatgaacgcgaacgagctggacgac
gtgatccgccactacgaggagatagtgtttgcgcggacgtcaccgcaacagaagctgctg
atcgtggagagctgccaacggctgggggaaatcgtggcggtcaccggcgacggagtcaac
gactcgccagcgttgcggaaggccgacatcgggatcgcgatgggcatcgccggttccgac
gtggcgaaaaacgccgcggacatgatactcatggatgacaatttcgcgtcgatcgtgacc
ggtgtcgaggagggccggctgatattcgacaatctaaagaaatcgatcgcgtacacactg
acgtcgagcgtgccggagatgctgcccatgctgagcggcctgatactcgcgatccctttg
cccctggtgatcgagctggtgatctgcatagatgtcggcaccgatctagtgcccgccatc
gctctggcgtacgagaaggcagagtccgatataatgcgccgagcaccaaggaatcctcag
tacgacaagctggtgaacaagcgcctgatatccatcacttatggtcagataggaatgacg
cagtcctttgccgggttctacacctactttatggtgctcatgatgaacggctttatgccg
actcgcttgttgggcctgcgaatagagtgggaggacccgtccatcaacgatctacgggac
tcctggggccaaacgtggacctacgagaacaggatgaacctgctgatggaggcgcagagc
ggatactttctctccatcgttatcacgcagatgatagatctggtaatgtgcaagaccagg
cgcaactcgatctttcaacaaggaatgggcaactggttcgtcaacttctccttcggtttc
gaagcgatcctaacggggctcctgctctacgttccaggcacggagtacgtcttccacact
atgccactgcaagcgttttggtactggccctgcttgccgctcggtatatttctttgggtc
tacgacgaattgagacgtttgtgcattcgtgtctttccaggcggaatcatggaaagagaa
acgtattactga

DBGET integrated database retrieval system