KEGG   Ooceraea biroi (clonal raider ant): 105287933Help
Entry
105287933         CDS       T05778                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
obo  Ooceraea biroi (clonal raider ant)
Pathway
obo00500  Starch and sucrose metabolism
obo01100  Metabolic pathways
Module
obo_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:obo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105287933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:obo01003]
    105287933
Enzymes [BR:obo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     105287933
Glycosyltransferases [BR:obo01003]
 Polysaccharide
  Storage polysaccharide
   105287933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 105287933
NCBI-ProteinID: XP_011352127
Position
2
AA seq 695 aa AA seqDB search
MSRERASRRFYRVDSTNDLFEFMDRGYSAQHENRWNFEVAWEAANKVGGIYTVIRSKAYV
STEEMGDQFCLIGPYKEHSARTEVEEADFPPHNPLHQAVQVLRDQGYKVVTGTWLVDGNP
QIILFDIGSAAWKLDEYKQELWSTCNLGIPHLDIEANDAVILGYLVCQFIAEFRKAAEGY
SSVPPRIVVHCHEWQAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGKTDFYNNLDKFS
VDEEAGKRQIYHRYCMERAATHLAHVFTTVSDITGFEAEHLLKRKPDIITPNGLNVKKFA
ALHEFQNLHAISKEKIHEFVRGHFYGHYDFDLDKTLYFFIAGRYEFGNKGADIFIEALAR
LNHYLKTSRPDLTVVAFLIFPAKTNNFNVESLRGHAVTKSLRDTINDIQQKIGKRMYELC
LSGRMPEAQDLLQKEDTIKIKRCLYALQRNGLPPITTHNVVDDWNDPVLNAVRRCNLFNT
VHDRVKMVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYIVDRRFIGLEMSVQQLAQYMFDFARLSRRQRIIQRNR
TERLSDLLDWRNLGIYYRQARIKALMTVYPELASEYAEGGVGRFNYPRPISEPPSPSSSR
HTTPAASVHGSDDEDDEDEVDDEKELEELRQTNGR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagggaacgcgcgtccagaagattttatcgcgtagatagtaccaatgatctgttt
gaattcatggaccgtggctactcggcccaacacgaaaatcgatggaatttcgaagttgca
tgggaagctgccaacaaagtcggtggcatttatacggtaataaggtccaaagcttacgtc
tcaactgaagaaatgggcgaccagttttgtctcattggtccgtacaaggaacattcagct
cgcaccgaagtggaggaagccgattttccccctcacaaccctttgcatcaagcggtacaa
gtgttgcgcgatcagggatacaaagtggtaacagggacatggctggtggacggaaatcct
caaatcattttatttgacattggaagtgccgcttggaagctggacgagtacaaacaagaa
ttatggagtacgtgcaatcttggaatacctcacctcgatatcgaagctaatgacgccgtg
atactcggatacttggtttgccaatttattgccgaatttaggaaggcagccgaaggatac
tcgagcgttccaccgagaatagtcgtgcattgtcacgaatggcaagcgggtgtcggatta
attgctttgagaacgagacacgttgatgtggctacggtgtttaccactcacgctactctt
ctcggtagatatctttgcgcgggaaagactgacttttacaacaatctagataagttcagt
gtcgacgaagaagcaggaaaacgtcaaatataccatagatattgcatggagcgcgctgcc
acacacctggcgcatgtatttacgacagtgtccgatatcactggtttcgaggcagagcac
ttgctcaagcgcaaacccgatatcattacaccgaacggattgaacgtaaagaaatttgct
gcattgcacgaatttcagaatttacatgcaattagtaaagagaagatacacgagtttgtg
cgcggtcacttttatggacactatgacttcgatttagacaaaacgttgtactttttcatc
gctggccgatacgaattcggaaataagggcgccgatatcttcatagaagccttggctaga
ttgaaccactacctaaaaacatccaggccagatttgaccgtggtagctttcctcattttt
cctgcaaaaaccaacaactttaatgtcgagtcacttcgcggccatgcggtaacgaaatcc
ttacgagacaccatcaacgatatacagcagaaaatagggaaacgtatgtacgaattgtgt
ctctctggtcgtatgcctgaagctcaggacctgttgcagaaagaagacaccatcaagata
aagcgttgtctatacgctctccaaagaaatggattgccgcctatcacaacgcacaacgtt
gtcgacgactggaatgatccggtgttgaatgccgttagaaggtgcaatctcttcaacacc
gtccacgatcgcgttaagatggtatttcatccggagtttctgtcttcgacgaatccgctg
tttgggctcgattacgaggagtttgtcagaggatgccacctgggcgtcttcccctcgtac
tatgaaccctggggatacacgccggctgaatgcacggtcatggggattcccagtatcacc
acgaatctatcaggcttcgggtgcttcatgcaggagcacatagcagatccgatgagttat
ggcatatacatcgtcgacagacgtttcatcggtttggaaatgagtgttcagcagctcgcc
cagtacatgttcgactttgcgcgactcagtcgccgtcaacgtatcatccagagaaaccgt
acggaacgtctgagcgatcttctcgattggcgaaatcttggcatttattaccgccaggcg
agaataaaggcgctcatgaccgtgtacccggaattggcatccgagtatgccgagggtgga
gtcggccgattcaattatcccagaccaatcagcgaaccaccatctccgtcatcctcgcga
cacacgacaccggctgcttcggtacacggttcggacgatgaggacgatgaggacgaggtt
gatgacgaaaaagagctggaagaattgcggcaaacgaatggaaggtaa

DBGET integrated database retrieval system