KEGG   Oryza brachyantha (malo sina): 102701558Help
Entry
102701558         CDS       T02995                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
obr  Oryza brachyantha (malo sina)
Brite
KEGG Orthology (KO) [BR:obr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:obr01001]
    102701558
   01009 Protein phosphatases and associated proteins [BR:obr01009]
    102701558
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102701558
Protein kinases [BR:obr01001]
 Serine/threonine kinases: Other
  Wnk family
   102701558
Protein phosphatases and associated proteins [BR:obr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102701558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C APH
Motif
Other DBs
NCBI-GeneID: 102701558
NCBI-ProteinID: XP_006657511
UniProt: J3MJ22
Position
7
AA seq 617 aa AA seqDB search
MMGALQVQSNGDAGRHGHGHHGGLLAVAAGYAEVDPTGRYGRYDEILGKGSSKIVYKGFD
EWRGVEVAWNQVRLRDVVHSASDLERLYGEVHLLAALRHRTIVRLDAYWIDAPRRVLNFV
TELFVSGTLRQYREKHRRVSMAAVRRWCRQILDGLAYLHGHEPPIIHCDLKCDNIFVNGN
QGEVKIGDLGLAAFRRGRHVRCVGTPEFMAPEVFDESYDELADVYSFGMCVLEMVTLDYP
YSECSNPIQIYKRVVSGIKPAALCSVRDPAVRQFIERCLAPAARRPAAAELLNDPFLLQL
EDDAFFSGDGGHGHGDGGGGGHGHGDGYYNLMYSYLHQPACIDHRVRSSGSMPSNGLSPS
NSVDDDNEADAAPSAGDDDGDNWLRDIHMLFDEDEDDAGERVAGVDVAIKGRRTEDGGVY
LGLRIADKNGTGRGRIICFRFDTEADTAMSVAAEMVAELDITDHEVTRIAELIDGKVAAL
VPGWRPATDDDDDVVTVDGDDPDAPGAAAACCKNCRPSSSSSSCGSLVEFMSSSAAAAAE
RGGCRRCAELHGRFEEITFQADDEEDEQHLQGSGCSSSETGGSSHGQAGQRAMDKDQELM
DITGSAQDGTGEGSEQP
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagccttgcaggtgcagagcaatggtgatgctggtcgccatggccatggccac
catggcggcctcctcgctgtggcagcagggtatgcagaggttgatcctaccgggagatat
ggcagatacgatgagattcttggcaagggctcgtcgaagatagtgtacaaggggtttgat
gagtggcggggagtggaggtggcgtggaaccaggtgcggctgcgggacgtcgtgcacagc
gccagcgacctggagcggctctacggcgaggtccacctcctcgcggcgctccgccaccgg
accatcgtgcgcctcgacgcctactggatcgacgcgccacgccgcgtcctcaacttcgtc
accgagctcttcgtctccggcacgctccgccagtacagggagaagcaccggcgggtgagc
atggcggcggtgcggcggtggtgcaggcagatcctcgacgggctcgcctacctccacggc
catgagccgccgatcatccactgcgacctcaagtgcgacaacatcttcgtgaacggcaac
cagggagaggtcaagatcggcgacctaggcctcgccgccttccgccgcggccgccacgtc
cgctgcgtcggcacgccggagttcatggcccccgaggtgttcgacgagtcctacgacgag
ctcgccgacgtctactccttcggcatgtgcgtcctcgagatggtcaccctcgattacccc
tacagcgagtgctccaaccccatccaaatctacaagcgagtcgtctccgggatcaagcct
gccgcgttgtgcagcgtgagggacccggcggtgaggcagttcatcgagcggtgccttgcc
ccggcggcgcggcggccggcggcggcggagctcctcaacgacccgttcctgctgcagctt
gaggacgacgccttcttctcaggcgacggcggccatggccatggagacggaggcggcggc
ggccatggccatggagacgggtactacaacttgatgtacagctacctccaccagcctgct
tgcatcgaccaccgtgtccgcagcagcggctccatgccgagcaacggcttgtcgccgtcg
aacagcgtcgacgacgacaatgaagcggacgcggcgccgtcggcgggggacgacgacggc
gacaactggctccgtgacatccacatgctgttcgacgaggacgaagacgacgccggcgag
cgtgtcgccggcgtggacgtcgccatcaaggggaggaggacggaggacggcggcgtctac
ctcgggctgcgcatcgccgacaagaacggcacagggcgtggccggataatctgcttccgg
ttcgacaccgaggccgacacggcgatgagcgtcgcggcggagatggtcgccgagctggac
atcaccgaccacgaggtgacacgcatcgccgagctaatcgacggcaaggtcgccgcgctg
gtgccggggtggaggccagccaccgacgacgacgacgacgtcgtcaccgtcgacggcgat
gacccggacgcgccgggcgccgccgccgcatgctgcaagaactgccggccgtcgtcgtcg
tcctcgtcctgcggctccctcgtcgagttcatgtcctcgtcagcggcggcggcggcggag
cgcggtggctgcaggcgctgcgccgagctgcacggccggttcgaggagatcacgttccaa
gccgacgacgaagaagacgagcagcatttgcagggctcagggtgcagctcttctgagacc
ggaggaagcagccacggccaggctgggcagcgcgccatggacaaggaccaggagctcatg
gacatcactggctctgcacaagatggcacaggagaaggttcagagcaaccatga

DBGET integrated database retrieval system