KEGG   Oryza brachyantha (malo sina): 102702128Help
Entry
102702128         CDS       T02995                                 

Definition
(RefSeq) probable protein S-acyltransferase 7
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
obr  Oryza brachyantha (malo sina)
Brite
Enzymes [BR:obr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102702128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC EI24 DUF2852
Motif
Other DBs
NCBI-GeneID: 102702128
NCBI-ProteinID: XP_006660819
UniProt: J3MZ15
Position
9
AA seq 440 aa AA seqDB search
MYGPPSRGVGAAGEQPRVYQVWKGSNEFFLQGRFIFGPDVRSLFLTIFLIVAPVLVFCIF
VARHLINDFPDHWGVSVMVIVVVFTIYDLTLLLLTSGRDPGIVPRNTHPPEPESIDGGSD
MGNGQTPQQLRLPRTKDVFVNGVIVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPW
VGQCIGRRNYRFFYMFVFSTTLLCLYVFGFCWVYIVKIRDAEHSSIWKAMLKTPASIVLI
IYCFICVWFVGGLSVFHFYLMSTNQTTYENFRYRYDQRANPYNRGMVNNFLEIFCTAIPP
SKNNFRARVPVDQGLQQIRTPARGFMSPNMGKPVGDLELGRKPVSWDEPRSAADIRDLEV
GLGGLLDEKEGRIAHASPDLSRGHLPAELVEGRAGMHSRRSSWGHRSGTSESMDSIAVQM
GTEANWGSMSSGHGTTSSTH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggccgccgtcccgcggcgtcggggccgccggcgagcagcctagggtttaccaa
gtttggaagggaagcaacgagtttttcttgcaagggcggttcatttttgggcccgatgtg
agatccttgtttctcactatattcctcattgttgcaccagtattagtcttctgtatattt
gtggccaggcatctgatcaatgacttccctgatcactggggagtttcagttatggtcata
gtggttgtcttcacaatatatgatttgacattgctgcttcttacctctggtagagaccct
ggtatagttccacgtaatactcatccacctgagcctgaatcgattgatgggggcagtgat
atgggaaatggacagactccgcaacaactgcgtttaccacgaacaaaggatgtttttgtt
aatggagtcattgttaaggtcaaatactgtgacacctgcatgctgtaccggccacctcga
tgttctcactgttctatatgtaataactgtgtggagcgttttgatcatcactgcccttgg
gttgggcaatgcataggacgaagaaattaccgattcttctacatgttcgtattctcaact
acattactatgcctctatgtatttggcttctgctgggtgtacattgttaaaatcagagat
gcagagcattcttcgatttggaaagcaatgttgaagacaccagcatcaattgttctgatt
atctactgctttatttgcgtgtggttcgttggtggtttgtctgtctttcatttctacctg
atgagcaccaatcagacaacctatgagaactttaggtatcgatatgatcaacgggctaac
ccatataacagaggtatggtgaacaactttctggagatcttctgcaccgcaattcctcct
tccaagaacaatttccgagctagggtcccagtagatcaaggtctacaacaaatacgaacg
cctgctaggggtttcatgagcccgaacatgggtaaaccagttggagatcttgaattgggt
aggaagcctgtatcatgggatgagcctcggtcagcagcagatataagagatttagaagtt
ggtctcggggggctcttggatgaaaaagagggtagaatagcccatgcatcgccagatctt
agcagaggacatcttccggccgagcttgtggaaggtagggctggtatgcactcgagacga
tcaagctggggtcacagaagtggaacctctgagtcaatggacagcatcgcagtgcagatg
ggaactgaagctaactggggttcaatgagtagtggccatggcaccaccagttcaacccac
tag

DBGET integrated database retrieval system