KEGG   Oryza brachyantha (malo sina): 102702257Help
Entry
102702257         CDS       T02995                                 

Definition
(RefSeq) aspartate--tRNA ligase 2, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:obr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102702257
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:obr01007]
    102702257
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:obr03016]
    102702257
Enzymes [BR:obr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     102702257
Amino acid related enzymes [BR:obr01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   102702257
Transfer RNA biogenesis [BR:obr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102702257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2
Motif
Other DBs
NCBI-GeneID: 102702257
NCBI-ProteinID: XP_015688449
Position
2
AA seq 451 aa AA seqDB search
MSTGDESHGDPRPEEADAGYGDVTGGELFGAPGYGWADVAALGPGMAGFAAGLSRESVVD
VAGVVSLPREPVRGTTQQGVEIQVKKLYCISRATPNLPISVDDAARSEEDVARAKAAGEQ
LVHVGQDKRLDYRVIDLRTPANQAIFRVQCEVENIFRKVLLSEGFVGIHTPKLLGGASEG
GAAVFKLDYNGQPACLAQSPQLHKQTAICGGFERVFEVGPVFRAEDSNTHRHLCEFVGLD
MEMAIKDHYSEVCDVVDRLFVAMFDHLNKNCAKELEAIHRQYPFKPLKYLPKTLRIDYDE
GIRMLKEAGVHVEDMGDLKTEAERKLGELVQAKFDTDFYMLCRYPSAVRPFYTMPCSDDP
RYSNSFDVFVRGEEIISGAQRVHVPEVLTKQAAAGGVDVGSIAAYVESFGYGAPPHGGFG
VGLERVVTLFCGLGNIRKASLFPRDPRRLTP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccggcgacgagagccacggcgatccgcggccggaggaggccgacgctggctac
ggcgacgtcaccggcggggagctgttcggtgcccccggctacggctgggcagacgtggcg
gcgctggggcccgggatggccggcttcgccgcggggctgagccgggagtcggtggtggac
gtcgccggcgtcgtctcgctgccgcgggagcccgtccgcggcaccacgcagcagggggtg
gagatccaagtgaagaagctctactgcatcagcagagcgaccccgaacctgcccatcagc
gtggacgacgcggcgcgaagcgaggaagatgtcgcgagggccaaggctgccggcgagcag
ctcgttcatgttgggcaggacaagcgcctcgactaccgagtgatcgacctgcgcacacct
gcaaaccaggcgattttccgtgttcaatgcgaagttgaaaacatcttcaggaaggtgttg
ctgtcggaaggtttcgttggcatccacacgccgaagctgctcggcggggccagcgaaggc
ggcgcggcggtgttcaagctggactacaacgggcagcctgcgtgcctggcgcagtcgccc
cagctccacaagcagacggcaatctgcggcgggttcgagcgcgtcttcgaggttggcccc
gtgttcagggcagaggactccaacacgcaccgccatctgtgtgagttcgttggcctcgac
atggagatggcaatcaaagaccattactccgaggtttgtgatgttgtggataggctgttc
gttgctatgttcgatcatctgaacaagaactgcgccaaggaattagaggctattcacagg
cagtatccatttaaacctttgaagtacttaccgaagacactgcgcattgactatgacgaa
ggcatccggatgctcaaggaagccggggtccatgtggaggacatgggagacctcaaaaca
gaggctgaaaggaagctgggtgagctggttcaggccaagttcgacactgacttttacatg
ctctgccggtacccgtcggcggtgaggccgttctacaccatgccctgctccgacgaccct
cgctacagcaactccttcgacgtgttcgtccgaggggaggagatcatctcgggagcacag
agggtgcacgtcccggaggtcctgacgaagcaggcggcggcggggggggtcgacgtgggc
agcatcgccgcgtacgtggagtcgttcgggtacggcgcgccgccgcacggagggttcggc
gtggggctggagagggtggtgacgctcttctgcggcctcggcaacatcaggaaggcgtcg
ctcttcccacgcgaccccaggaggctgaccccctga

DBGET integrated database retrieval system